BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0548.0006.p
         (47 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SP1798 [G] COG4209 ABC-type polysaccharide transport system, per...    48   4e-06

>SP1798 [G] COG4209 ABC-type polysaccharide transport system, permease
          component
          Length = 305

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (65%)

Query: 1  MVVPAMLFIFVFSYLPMYGVLMAFQDYQLFGGFFHSPW 38
          M VP ++  F+F Y+PMYGVL+AF+DY    G   S W
Sbjct: 23 MTVPGLVLTFIFKYIPMYGVLIAFKDYNPLKGILGSDW 60


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.343    0.153    0.538 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 2,653,597
Number of extensions: 57212
Number of successful extensions: 241
Number of sequences better than 1.0e-05: 4
Number of HSP's gapped: 241
Number of HSP's successfully gapped: 4
Length of query: 47
Length of database: 38,378,431
Length adjustment: 20
Effective length of query: 27
Effective length of database: 36,071,751
Effective search space: 973937277
Effective search space used: 973937277
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (22.0 bits)
S2: 109 (46.6 bits)