BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0545.0011.p (727 letters) Database: COG 115,334 sequences; 38,378,431 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value lin0469 [E] COG1305 Transglutaminase-like enzymes, putative cyst... 155 3e-37 BH0606 [E] COG1305 Transglutaminase-like enzymes, putative cyste... 140 5e-33 alr0103 [E] COG1305 Transglutaminase-like enzymes, putative cyst... 87 9e-17 sll1608 [E] COG1305 Transglutaminase-like enzymes, putative cyst... 84 1e-15 PAB1274_1 [E] COG1305 Transglutaminase-like enzymes, putative cy... 81 5e-15 >lin0469 [E] COG1305 Transglutaminase-like enzymes, putative cysteine proteases Length = 252 Score = 155 bits (391), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 0/320 (0%), Positives = 0/320 (0%), Gaps = 43/320 (13%) Query: 250 LGGGFNFDYSPVMTVTADLRTYMRGETRSVYSGTGWS-----DDNPFTRGDLKGGVVGQP 304 Sbjct: 252 ------ 305 Query: 305 LEQNKASKVQTRELKQTVKILGGNSY-PVLFGGLSI-SKVNSVNGADTSSSLLWRSEGSE 362 Sbjct: 306 ---------- 355 Query: 363 LLWESVENSRAYPREYVLTSQVPVIPIQELNKQTYEQLYGGLDIDQQYLQLPGNFPERVR 422 Sbjct: 356 --------- 406 Query: 423 ELAEKVTAQGKTPYEKIALLQQYLQQS--FPYTNQPDLSRRKSKDLVESFLFEIMEGYCD 480 Sbjct: 407 466 Query: 481 YYSTALVTMARSLDIPARWVKGYAPGEQAELPDNLAVQQGGAVLNNNYTITNADAHSWAE 540 Sbjct: 467 --------- 517 Query: 541 VYFGDYGWIPVEATPGFTAP 560 Sbjct: 518 537 >BH0606 [E] COG1305 Transglutaminase-like enzymes, putative cysteine proteases Length = 252 Score = 140 bits (354), Expect = 5e-33, Method: Compositional matrix adjust. Identities = 0/313 (0%), Positives = 0/313 (0%), Gaps = 33/313 (10%) Query: 250 LGGGFNFDYSPVMTVTADLRTYMRGETRSVYSGTGWSDDNPFTRGDLKGGVVGQPLEQNK 309 Sbjct: 263 ------ 316 Query: 310 ASKVQTRELKQTVKILGGNS-YPVLF--GGLSISKVNSVNGADTSSSLLWRSEGSELLWE 366 Sbjct: 317 376 Query: 367 SVENSRAYPREYVLTSQVPVIPIQELNKQTYEQLYGGLDIDQQYLQLPGNFPERVRELAE 426 Sbjct: 377 ------------- 423 Query: 427 KVTAQGKTPYEKIALLQQYLQQS-FPYTNQPDLSRRKSKDLVESFLFEIMEGYCDYYSTA 485 Sbjct: 424 483 Query: 486 LVTMARSLDIPARWVKGYAPGEQAELPDNLAVQQGGAVLNNNYTITNADAHSWAEVYFGD 545 Sbjct: 484 ---------- 533 Query: 546 YGWIPVEATPGFT 558 Sbjct: 534 546 >alr0103 [E] COG1305 Transglutaminase-like enzymes, putative cysteine proteases Length = 252 Score = 87.0 bits (214), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 0/204 (0%), Positives = 0/204 (0%), Gaps = 36/204 (17%) Query: 378 YVLTSQVPVIPIQELNKQTYEQLYGGLDIDQQYLQLPGNFPERVRELAEKVTAQGK---- 433 Sbjct: 418 --- 474 Query: 434 --------TPYEKIALLQQYLQQSFPYTNQP----DLSRRKSKDLVESFLFEIMEGYCDY 481 Sbjct: 475 -- 532 Query: 482 YSTALVTMARSLDIPARWVKGYAPGEQAELPDNLAVQQGGAVLNNNYTITNADAHSWAEV 541 Sbjct: 533 ------------- 579 Query: 542 YFGDYGWIPVEATPGFTAPLLAQS 565 Sbjct: 580 -- 601 >sll1608 [E] COG1305 Transglutaminase-like enzymes, putative cysteine proteases Length = 770 Score = 83.6 bits (205), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 61/184 (33%), Positives = 90/184 (48%), Gaps = 23/184 (12%) Query: 378 YVLTSQVPVIPIQELNKQTYEQLYGGLDIDQQYLQLPGNFPERVRELAEKVTAQGK---- 433 Y + S+VPV ++ + ++ + ID Q LQ+P + VR A+++ A+ + Sbjct: 419 YTVISEVPV---RDRTRLQEYRIPPEVKIDPQLLQVPPDIKSAVRVKAQELLAKSERPLE 475 Query: 434 TPYEKIALLQQYLQQSFPYTNQPDLSR-RKSKDLVESFLFEIMEGYCDYYSTALVTMARS 492 TPYE L Q L+Q+ Y + DL +DLV +FLFE G D+++T L M RS Sbjct: 476 TPYEISLYLTQALKQN--YRIRTDLPFFEDDEDLVSAFLFEYEGGLPDHFATVLTIMLRS 533 Query: 493 LDIPARWVKGYAPGEQAELPDNLAVQQGGAVLNNNYTITNADAHSWAEVYFGDYGWIPVE 552 LDIPAR G+APG+ Y + N DA++ EV F GW + Sbjct: 534 LDIPARLTVGFAPGQFNP-------------FTGYYLVHNTDAYALTEVLFPRLGWFMFD 580 Query: 553 ATPG 556 PG Sbjct: 581 PIPG 584 >PAB1274_1 [E] COG1305 Transglutaminase-like enzymes, putative cysteine proteases Length = 252 Score = 81.3 bits (199), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 0/147 (0%), Positives = 0/147 (0%), Gaps = 18/147 (12%) Query: 408 QQYLQLPGNFPERVRELAEKVTAQGKTPYEKIALLQQYLQQSFPYTNQPDLSRRKSKDLV 467 + + + A + L + QQ F + + Sbjct: 176 VDIWRTT-YYHQMPSHQAIIDWVTATGLRPWLQDLTESEQQLFLKRYH-QMLEEQYPLQE 233 Query: 468 ESFLFEIMEGYCDYYSTALVTMARSLDIPARWVKGYAPGEQAELPDNLAVQQGGAVLNNN 527 Sbjct: 234 ---------- 283 Query: 528 YTITNADAHSWAEVYFGDYGWIPVEAT 554 Sbjct: 284 ------ 304 Database: COG Posted date: Aug 3, 2010 9:58 AM Number of letters in database: 38,378,431 Number of sequences in database: 115,334 Lambda K H 0.318 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 115334 Number of Hits to DB: 47,361,225 Number of extensions: 1827907 Number of successful extensions: 12721 Number of sequences better than 1.0e-05: 10 Number of HSP's gapped: 12714 Number of HSP's successfully gapped: 10 Length of query: 727 Length of database: 38,378,431 Length adjustment: 114 Effective length of query: 613 Effective length of database: 25,230,355 Effective search space: 15466207615 Effective search space used: 15466207615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 120 (50.8 bits)