BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0534.0029.p (291 letters) Database: COG 115,334 sequences; 38,378,431 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SSO2112 [R] COG2159 Predicted metal-dependent hydrolase of the T... 69 1e-11 AGc2623 [R] COG2159 Predicted metal-dependent hydrolase of the T... 66 6e-11 SSO3016 [R] COG2159 Predicted metal-dependent hydrolase of the T... 57 4e-08 Rv2303c [R] COG2159 Predicted metal-dependent hydrolase of the T... 56 8e-08 MT2360 [R] COG2159 Predicted metal-dependent hydrolase of the TI... 56 8e-08 >SSO2112 [R] COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold Length = 269 Score = 68.6 bits (166), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 54/211 (25%), Positives = 99/211 (46%), Gaps = 26/211 (12%) Query: 79 LMECVGINPNRLAGAQAQAELDRIEARMQAPEVAGIKLYAGYYHYYVHDKIYAPVYELAA 138 +++ + ++P++ A EL R ++ E G+KL+ ++ D+ +YE+ Sbjct: 78 IVKFISVDPSK---PNADEELKR---SIKEFEPVGVKLHPQLQGFHPLDERALKIYEIID 131 Query: 139 KYSLPVVIHTGDTYSMNGL-----LKYSHPLTVDELAYQQRGVNFMICHLGDPWVMDAAE 193 + L VV HTG + G+ L Y P+ DE+A + + + ++ H G PW +A Sbjct: 132 NHGLIVVFHTGTSGIGAGVKSSIRLDYGRPIYFDEIAVRFQNMKIILAHFGWPWTEEAIA 191 Query: 194 VVAKNPNVYADLSGLVVGDRPHFERFMNEPLFMDHFRRALVYCDHYEKMLFGTDWPLA-P 252 + PNVY DLSG R++ + ++ + R + +K+LFG+D+PL P Sbjct: 192 IALHKPNVYLDLSGWA-------PRYIPQVIWSNAKRLS-------DKLLFGSDFPLIRP 237 Query: 253 IGLYAEFIRRLVPGQHHEKVFYRNAFELFPR 283 EF + +K+ NA +L + Sbjct: 238 ERWLEEFKSVNLSQDIKDKILKHNAEKLVKK 268 >AGc2623 [R] COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold Length = 291 Score = 66.2 bits (160), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 44/146 (30%), Positives = 68/146 (46%), Gaps = 20/146 (13%) Query: 111 VAGIKLYAGYYHYYVHDKIYAPVYELAAKYSLPVVIHTGDTYSMNGL-------LKYSHP 163 V G K + +Y +D++ P+YE A+ + HTG T GL LK+S+P Sbjct: 124 VKGFKFHPTMQGFYPNDRMAYPLYEAIAEEGAITLFHTGQTGVGAGLRGGMAMRLKFSNP 183 Query: 164 LTVDELAYQQRGVNFMICHLGDPWVMDAAEVVAKNPNVYADLSGLVVGDRPHFERFMNEP 223 + +D++A + ++ H PW +A V PNVY D+SG P P Sbjct: 184 IHLDDVAVDFPDMPIILAHPSFPWQEEALSVATHKPNVYIDMSGWSPKYFP--------P 235 Query: 224 LFMDHFRRALVYCDHYEKMLFGTDWP 249 + + + L + KMLFG+DWP Sbjct: 236 ILVQYANSLLKH-----KMLFGSDWP 256 >SSO3016 [R] COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold Length = 286 Score = 56.6 bits (135), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 42/136 (30%), Positives = 72/136 (52%), Gaps = 17/136 (12%) Query: 84 GINPNRLAGAQAQAELDRIEARMQAPEVAGIKLYAGYYHYYVHDKIYAP----------V 133 GI PNR++ +A+ D +E + +A V+G KL+ H +V Y + Sbjct: 91 GIEPNRISLNEAK---DWLERQYEA-GVSGFKLHP--VHSHVKPNAYREEEGGLKQLELL 144 Query: 134 YELAAKYSLPVVIHTGDTYSMNGLLKYSHPLTVDELAYQQRGVNFMICHLGDP-WVMDAA 192 YE A ++LPVVIHTG + + KY+ P+ VD++A + ++ H+G P +V A Sbjct: 145 YEFAQDHNLPVVIHTGTSVFLKARNKYADPIFVDDVAVDFPQLKIVLAHMGRPNYVPTAF 204 Query: 193 EVVAKNPNVYADLSGL 208 ++V N+Y ++S + Sbjct: 205 QLVRIRRNLYGEISSI 220 >Rv2303c [R] COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold Length = 307 Score = 55.8 bits (133), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 26/81 (32%), Positives = 42/81 (51%) Query: 127 DKIYAPVYELAAKYSLPVVIHTGDTYSMNGLLKYSHPLTVDELAYQQRGVNFMICHLGDP 186 D Y P Y + +PV IHT ++ L HP +D++A + + ++ H G P Sbjct: 153 DPAYFPCYAKCVELGVPVSIHTSADWTRTRLSDLGHPRHIDDVACRFPELTILMSHGGYP 212 Query: 187 WVMDAAEVVAKNPNVYADLSG 207 WV+ A + K+PNVY +L+ Sbjct: 213 WVLQACLIAWKHPNVYLELAA 233 >MT2360 [R] COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold Length = 307 Score = 55.8 bits (133), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 26/81 (32%), Positives = 42/81 (51%) Query: 127 DKIYAPVYELAAKYSLPVVIHTGDTYSMNGLLKYSHPLTVDELAYQQRGVNFMICHLGDP 186 D Y P Y + +PV IHT ++ L HP +D++A + + ++ H G P Sbjct: 153 DPAYFPCYAKCVELGVPVSIHTSADWTRTRLSDLGHPRHIDDVACRFPELTILMSHGGYP 212 Query: 187 WVMDAAEVVAKNPNVYADLSG 207 WV+ A + K+PNVY +L+ Sbjct: 213 WVLQACLIAWKHPNVYLELAA 233 Database: COG Posted date: Aug 3, 2010 9:58 AM Number of letters in database: 38,378,431 Number of sequences in database: 115,334 Lambda K H 0.323 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 115334 Number of Hits to DB: 22,392,258 Number of extensions: 1024731 Number of successful extensions: 3716 Number of sequences better than 1.0e-05: 5 Number of HSP's gapped: 3715 Number of HSP's successfully gapped: 5 Length of query: 291 Length of database: 38,378,431 Length adjustment: 105 Effective length of query: 186 Effective length of database: 26,268,361 Effective search space: 4885915146 Effective search space used: 4885915146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 115 (48.9 bits)