BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0530.0022.p (160 letters) Database: COG 115,334 sequences; 38,378,431 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value FN0397 [EP] COG0601 ABC-type dipeptide/oligopeptide/nickel trans... 102 2e-22 BS_appB [EP] COG0601 ABC-type dipeptide/oligopeptide/nickel tran... 97 1e-20 MA0881 [EP] COG0601 ABC-type dipeptide/oligopeptide/nickel trans... 97 1e-20 DR1570 [EP] COG0601 ABC-type dipeptide/oligopeptide/nickel trans... 96 2e-20 NMA1247 [EH] COG0147 Anthranilate/para-aminobenzoate synthases c... 90 1e-18 >FN0397 [EP] COG0601 ABC-type dipeptide/oligopeptide/nickel transport systems, permease components Length = 308 Score = 102 bits (255), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 55/135 (40%), Positives = 80/135 (59%), Gaps = 1/135 (0%) Query: 2 MKTYVLRRLLIALPTFLGITILVFFVSYLASGSPLELLLSNQNISEAEIERQRIKLGLDQ 61 M Y+L+RL++ +P LG+T+LVF + YL G P +L+L EA + R K+GL+ Sbjct: 1 MYKYILKRLVLLIPVMLGVTLLVFTIMYLTPGDPAQLILGESAPKEA-VAALREKMGLND 59 Query: 62 PVYMQYFSWLGNMLTGNFGESYRTMEAVTSMILKGLGATSILVVASVLLACLIAIPLGIQ 121 P +MQYF ++ N L G+FG SY T V + I T +L V VL++ LI IP+GI Sbjct: 60 PFFMQYFRFVKNALVGDFGRSYTTGREVFAEIFARFPNTVVLAVLGVLISILIGIPVGII 119 Query: 122 SARHQSKLWDNLAAV 136 SA Q + D+ + V Sbjct: 120 SATKQYSITDSFSMV 134 >BS_appB [EP] COG0601 ABC-type dipeptide/oligopeptide/nickel transport systems, permease components Length = 317 Score = 96.7 bits (239), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 52/125 (41%), Positives = 80/125 (64%), Gaps = 2/125 (1%) Query: 2 MKTYVLRRLLIALPTFLGITILVFFVSYLASGSPLELLLSNQNISEAEIERQRIKLGLDQ 61 M Y++RR L+++P LGITIL F + A G P+ L++ + IS+A+ E+ K GL+ Sbjct: 1 MAAYIIRRTLMSIPILLGITILSFVIMKAAPGDPMTLMM-DPKISQADREQFIEKYGLND 59 Query: 62 PVYMQYFSWLGNMLTGNFGES-YRTMEAVTSMILKGLGATSILVVASVLLACLIAIPLGI 120 P Y+QY WLGNM+ G+FG S R V+ +I+ L T +L++ S +LA +I+IP G+ Sbjct: 60 PQYVQYLKWLGNMVQGDFGTSIVRKGTPVSELIMARLPNTLLLMLVSTILALMISIPFGV 119 Query: 121 QSARH 125 SA+ Sbjct: 120 LSAKR 124 >MA0881 [EP] COG0601 ABC-type dipeptide/oligopeptide/nickel transport systems, permease components Length = 259 Score = 96.7 bits (239), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 53/137 (38%), Positives = 83/137 (60%), Gaps = 4/137 (2%) Query: 2 MKTYVLRRLLIALPTFLGITILVFFVSYLASGSPLELLLSNQNISEA----EIERQRIKL 57 M ++L+R+++ LG+T+L F + + G P E++ ++ +E+ IER R++ Sbjct: 1 MLKFILKRMVLMFIVILGVTMLTFLIMHFTPGDPAEMIALARHGAESLTPENIERIRVEE 60 Query: 58 GLDQPVYMQYFSWLGNMLTGNFGESYRTMEAVTSMILKGLGATSILVVASVLLACLIAIP 117 GLD PV++QY WL ++L G+ G S E V S IL AT L +AS+ +A +IAIP Sbjct: 61 GLDAPVHIQYIKWLQHLLHGDLGCSLINGEPVLSEILDRFPATLKLALASMFIALIIAIP 120 Query: 118 LGIQSARHQSKLWDNLA 134 LGI +A Q L+DNL+ Sbjct: 121 LGIITASKQYSLFDNLS 137 >DR1570 [EP] COG0601 ABC-type dipeptide/oligopeptide/nickel transport systems, permease components Length = 333 Score = 96.3 bits (238), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 50/129 (38%), Positives = 75/129 (58%) Query: 5 YVLRRLLIALPTFLGITILVFFVSYLASGSPLELLLSNQNISEAEIERQRIKLGLDQPVY 64 Y+LRR+L +PTF+ T+L FF++ A G L L N ++ IER R + GLDQPV+ Sbjct: 10 YILRRVLQFIPTFVLATMLAFFITQAAPGDFLSQLKENPSVKPETIERLRREFGLDQPVF 69 Query: 65 MQYFSWLGNMLTGNFGESYRTMEAVTSMILKGLGATSILVVASVLLACLIAIPLGIQSAR 124 +QY W N+L G+ G+S++ V +I + ILVV S +L ++IP+G+ SA Sbjct: 70 VQYLYWFKNLLMGDLGDSFQYKRPVAEVIQGPFLNSLILVVISTVLHFAVSIPVGVYSAL 129 Query: 125 HQSKLWDNL 133 WD + Sbjct: 130 KPYSFWDRV 138 >NMA1247 [EH] COG0147 Anthranilate/para-aminobenzoate synthases component I Length = 316 Score = 90.1 bits (222), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/134 (35%), Positives = 75/134 (55%), Gaps = 2/134 (1%) Query: 1 MMKTYVLRRLLIALPTFLGITILVFFVSYLASGSPLELLLSNQN--ISEAEIERQRIKLG 58 M+K Y +RR L P + I+ + F + Y+A G P E+++++ + EA +E RI G Sbjct: 1 MLKEYFIRRALYLFPVLIFISFMSFSLIYIAPGDPAEIMMTSPSGGYDEAAVEAFRIAHG 60 Query: 59 LDQPVYMQYFSWLGNMLTGNFGESYRTMEAVTSMILKGLGATSILVVASVLLACLIAIPL 118 LDQP Y+QY +WL G+FG SY + + V +L T L V ++ +A I+IP Sbjct: 61 LDQPFYIQYLNWLKAAAVGDFGYSYMSEQPVFETVLNAFKNTLTLSVLALAIALFISIPF 120 Query: 119 GIQSARHQSKLWDN 132 G+ SA + + D+ Sbjct: 121 GVVSALKHNTIVDD 134 Database: COG Posted date: Aug 3, 2010 9:58 AM Number of letters in database: 38,378,431 Number of sequences in database: 115,334 Lambda K H 0.328 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 115334 Number of Hits to DB: 10,364,760 Number of extensions: 390676 Number of successful extensions: 1433 Number of sequences better than 1.0e-05: 145 Number of HSP's gapped: 1356 Number of HSP's successfully gapped: 145 Length of query: 160 Length of database: 38,378,431 Length adjustment: 98 Effective length of query: 62 Effective length of database: 27,075,699 Effective search space: 1678693338 Effective search space used: 1678693338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 111 (47.4 bits)