BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0529.0009.p
         (215 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TP0841 [O] COG0265 Trypsin-like serine proteases, typically peri...    49   7e-06

>TP0841 [O] COG0265 Trypsin-like serine proteases, typically periplasmic,
           contain C-terminal PDZ domain
          Length = 485

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%), Gaps = 8/71 (11%)

Query: 122 DAVRHGEAVFALGYPLKNTNIITEGIVNS------PDAEINGRSRILASAQVASGMSGGP 175
           DAVR G+ VFA+G PL  T+ +T+GI+++      P   IN    I   A +  G SGGP
Sbjct: 181 DAVRVGDIVFAVGSPLGYTSTVTQGIISALGRFGGPGNNIN--DFIQTDAAINQGNSGGP 238

Query: 176 LIDAHGQLAGI 186
           +++ +G++ GI
Sbjct: 239 MVNIYGEVIGI 249


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.317    0.133    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 12,397,832
Number of extensions: 417304
Number of successful extensions: 859
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 919
Number of HSP's successfully gapped: 2
Length of query: 215
Length of database: 38,378,431
Length adjustment: 102
Effective length of query: 113
Effective length of database: 26,614,363
Effective search space: 3007423019
Effective search space used: 3007423019
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 113 (48.1 bits)