BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0490.0005.p
         (60 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BH3448 [G] COG1879 ABC-type sugar transport system, periplasmic ...    49   3e-06

>BH3448 [G] COG1879 ABC-type sugar transport system, periplasmic
          component
          Length = 335

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 12 LKKLGLVYVLLIGLFLIYVLNYKLHPDPADPWDTAGLRGN 51
          +KKL LVYV LIGLF++YV +       A+PWDT GL+G+
Sbjct: 1  MKKLLLVYVALIGLFMLYVYHAHFKEPVANPWDTRGLQGD 40


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.327    0.151    0.470 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 4,478,874
Number of extensions: 134470
Number of successful extensions: 694
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 694
Number of HSP's successfully gapped: 1
Length of query: 60
Length of database: 38,378,431
Length adjustment: 32
Effective length of query: 28
Effective length of database: 34,687,743
Effective search space: 971256804
Effective search space used: 971256804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 109 (46.6 bits)