BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0489.0002.p (228 letters) Database: COG 115,334 sequences; 38,378,431 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SA0173_1 [Q] COG1020 Non-ribosomal peptide synthetase modules an... 125 7e-29 all2644_1 [Q] COG1020 Non-ribosomal peptide synthetase modules a... 118 8e-27 RSp0641_6 [Q] COG1020 Non-ribosomal peptide synthetase modules a... 116 2e-26 BS_pksK_1 [Q] COG1020 Non-ribosomal peptide synthetase modules a... 115 5e-26 RSp0641_5 [Q] COG1020 Non-ribosomal peptide synthetase modules a... 114 2e-25 >SA0173_1 [Q] COG1020 Non-ribosomal peptide synthetase modules and related proteins Length = 346 Score = 125 bits (313), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 0/178 (0%), Positives = 0/178 (0%), Gaps = 4/178 (2%) Query: 2 VKVRGYRIEAGEIEHTLYRLEGLKSAAVVAVNEGESNKLICYYTAARDIPVREIQACLQQ 61 Sbjct: 804 863 Query: 62 TLPLYMIPSRFIRLEVLPATSNGKTDRKALQALPLLREPAEQAVMHLPENDAEEFLLQVW 121 Sbjct: 864 ---- 919 Query: 122 RELLGIENIGTEQNFFDIGGNSHLIVQLQARIEQKYMKRVKVIDLFRCKTVRAMADYI 179 Sbjct: 920 977 >all2644_1 [Q] COG1020 Non-ribosomal peptide synthetase modules and related proteins Length = 346 Score = 118 bits (295), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 0/188 (0%), Positives = 0/188 (0%), Gaps = 11/188 (5%) Query: 2 VKVRGYRIEAGEIEHTLYRLEGLKSAAVVAVNEGESN--KLICYYTA-ARDIPVREIQAC 58 Sbjct: 887 - 945 Query: 59 LQQTLPLYMIPSRFIRLEVLPATSNGKTDRKALQALPLLREPAEQA-VMHLPENDAEEFL 117 Sbjct: 946 ------ 999 Query: 118 LQVWRELLGIENIGTEQNFFDIGGNSHLIVQLQARIEQKYMKRVKVIDLFRCKTVRAMAD 177 Sbjct: 1000 1059 Query: 178 YIQGSAQE 185 Sbjct: 1060 1067 >RSp0641_6 [Q] COG1020 Non-ribosomal peptide synthetase modules and related proteins Length = 346 Score = 116 bits (291), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 0/192 (0%), Positives = 0/192 (0%), Gaps = 18/192 (9%) Query: 2 VKVRGYRIEAGEIEHTLYRLEGLKSAAVVAVNE---GESNKLICYYTAARDIPVREIQAC 58 Sbjct: 852 -- 909 Query: 59 LQQTLPLYMIPSRFIRLEVLPATSNGKTDRKALQALPLLREPAEQA----VMHLPENDAE 114 Sbjct: 910 ------ 963 Query: 115 EFLLQVWRELLGIENIGTEQNFFDIGGNSHLIVQLQARIEQKYMKRVKVIDLFRCKTVRA 174 Sbjct: 964 1023 Query: 175 MADYI---QGSA 183 Sbjct: 1024 1035 >BS_pksK_1 [Q] COG1020 Non-ribosomal peptide synthetase modules and related proteins Length = 346 Score = 115 bits (288), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 0/214 (0%), Positives = 0/214 (0%), Gaps = 9/214 (4%) Query: 2 VKVRGYRIEAGEIEHTLYRLEGLKSAAVVAVNEGESNKLICYYTAAR---DIPVREIQAC 58 Sbjct: 955 ---- 1010 Query: 59 LQQTLPLYMIPSRFIRLEVLPATSNGKTDRKALQALPLLREPAEQAVMHLPENDAEEFLL 118 Sbjct: 1011 -- 1068 Query: 119 QVWRELLGIENIGTEQNFFDIGGNSHLIVQLQARIEQKYMKRVKVIDLFRCKTVRAMADY 178 Sbjct: 1069 1128 Query: 179 IQGSAQEPEQADAKTKPGKTQDDISDIMQLLDEY 212 Sbjct: 1129 1162 >RSp0641_5 [Q] COG1020 Non-ribosomal peptide synthetase modules and related proteins Length = 346 Score = 114 bits (284), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 0/188 (0%), Positives = 0/188 (0%), Gaps = 10/188 (5%) Query: 2 VKVRGYRIEAGEIEHTLYRLEGLKSAAVVAVNE---GESNKLICYYTAARDIPVREIQAC 58 Sbjct: 864 -- 921 Query: 59 LQQTLPLYMIPSRFIRLEVLPATSNGKTDRKALQALPLLREPAEQAVMHLPENDAEEFLL 118 Sbjct: 922 -- 979 Query: 119 QVWRELLGIENIGTEQNFFDIGGNSHLIVQLQARIEQKYMKRVKVIDLFRCKTVRAMADY 178 Sbjct: 980 1039 Query: 179 I---QGSA 183 Sbjct: 1040 1047 Database: COG Posted date: Aug 3, 2010 9:58 AM Number of letters in database: 38,378,431 Number of sequences in database: 115,334 Lambda K H 0.317 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 115334 Number of Hits to DB: 16,047,293 Number of extensions: 576082 Number of successful extensions: 3227 Number of sequences better than 1.0e-05: 51 Number of HSP's gapped: 3179 Number of HSP's successfully gapped: 53 Length of query: 228 Length of database: 38,378,431 Length adjustment: 103 Effective length of query: 125 Effective length of database: 26,499,029 Effective search space: 3312378625 Effective search space used: 3312378625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 114 (48.5 bits)