BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0450.0015.p
         (197 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BH0677_1 [K] COG0640 Predicted transcriptional regulators              48   7e-06

>BH0677_1 [K] COG0640 Predicted transcriptional regulators
          Length = 96

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 37 KLNLSQPTVTHHAAKLREAALIKERRDKNTVYFALNPEFIQAGSEASLKFIFAKGVEEM 95
          KL L+ PT++HH +KLRE  ++ +RR+KNT+YF L+ + ++  + A    I   G +EM
Sbjct: 38 KLGLTPPTISHHLSKLREIDVVYQRREKNTIYFYLDEKKLERMAGA----ILMIGGDEM 92


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.319    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 12,551,011
Number of extensions: 489994
Number of successful extensions: 2245
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 2245
Number of HSP's successfully gapped: 1
Length of query: 197
Length of database: 38,378,431
Length adjustment: 101
Effective length of query: 96
Effective length of database: 26,729,697
Effective search space: 2566050912
Effective search space used: 2566050912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 113 (48.1 bits)