BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0437.0040.p
         (70 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAC3381 [O] COG0330 Membrane protease subunits, stomatin/prohibi...    55   3e-08

>CAC3381 [O] COG0330 Membrane protease subunits, stomatin/prohibitin
           homologs
          Length = 365

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (82%)

Query: 22  VQRQEEDVATFILSRIQEKEEEFGVRFLGAGVKDVILPGEM 62
           +  Q+E++  FILSR++EKE E+ V F+GAG+KD+ILPGE+
Sbjct: 243 ILNQKEEIGGFILSRLKEKEREYYVEFIGAGIKDIILPGEV 283


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.319    0.140    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 4,991,808
Number of extensions: 196615
Number of successful extensions: 301
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 301
Number of HSP's successfully gapped: 1
Length of query: 70
Length of database: 38,378,431
Length adjustment: 42
Effective length of query: 28
Effective length of database: 33,534,403
Effective search space: 938963284
Effective search space used: 938963284
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 109 (46.6 bits)