BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0370.0007.p
         (188 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SMa1660 [KR] COG0454 Histone acetyltransferase HPA2 and related ...    54   1e-07

>SMa1660 [KR] COG0454 Histone acetyltransferase HPA2 and related
           acetyltransferases
          Length = 194

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 112 HHYLIMIGVKPEAQGKGVGTALLKHLLETVNTDKQSQGLALDTENKRNIALYQNFGFTLS 171
           H YL +IGV P  QGKG G AL+ + LE    D+      L++ N RNI  Y+ +GF   
Sbjct: 118 HWYLPLIGVDPAHQGKGHGDALMAYALE--RCDRDHAPAYLESSNPRNIPFYRRYGFEPL 175

Query: 172 KDTQVGQIPV 181
              Q G  P 
Sbjct: 176 GAIQFGSSPT 185


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.324    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 12,561,879
Number of extensions: 465833
Number of successful extensions: 1073
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 1093
Number of HSP's successfully gapped: 1
Length of query: 188
Length of database: 38,378,431
Length adjustment: 100
Effective length of query: 88
Effective length of database: 26,845,031
Effective search space: 2362362728
Effective search space used: 2362362728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 112 (47.8 bits)