BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0307.0082.p (530 letters) Database: COG 115,334 sequences; 38,378,431 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value lin1114_2 [K] COG2207 AraC-type DNA-binding domain-containing pr... 81 4e-15 BH3842 [T] COG4753 Response regulator containing CheY-like recei... 76 2e-13 SP0661 [T] COG4753 Response regulator containing CheY-like recei... 73 1e-12 BH1910 [T] COG4753 Response regulator containing CheY-like recei... 70 8e-12 lin1152 [K] COG2207 AraC-type DNA-binding domain-containing prot... 69 2e-11 >lin1114_2 [K] COG2207 AraC-type DNA-binding domain-containing proteins Length = 145 Score = 81.3 bits (199), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 45/113 (39%), Positives = 72/113 (63%), Gaps = 3/113 (2%) Query: 408 HTLAPTSAQ-GKDIRLLAIDQFLDEHVDRMITSLEMAEHLHLNASYFSRYFKKLAGVNFT 466 H PT + K+IR ++++++++R IT E+A H++L++ YFS+ FKK VNF Sbjct: 31 HHNKPTHHEDNKEIRKAL--KYIEKNLNRPITLDEVASHVYLSSYYFSKLFKKEMNVNFI 88 Query: 467 DYVNQYKINLAITMLSRQHETVENVAYTLGFSDRAYFSKVFKKYSGKSPSEYK 519 +YVNQ K++LA ML +++NVA LGF+ +YF KVF+K +P Y+ Sbjct: 89 NYVNQKKMSLAKDMLKNPRWSIDNVARNLGFTQTSYFCKVFRKEFDVTPKGYR 141 >BH3842 [T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain Length = 530 Score = 75.9 bits (185), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 36/102 (35%), Positives = 66/102 (64%), Gaps = 1/102 (0%) Query: 422 LLAIDQFLDEHVDRMITSLEMAEHLHLNASYFSRYFKKLAGVNFTDYVNQYKINLAITML 481 LLA D ++ +H +T ++A+H+ L+ Y S+ FK+ + F++YV Q ++ A +L Sbjct: 418 LLARD-YVHDHFREPLTLDDLAKHIGLSPYYVSKLFKERFDLTFSEYVTQLRVEHAKQLL 476 Query: 482 SRQHETVENVAYTLGFSDRAYFSKVFKKYSGKSPSEYKNQVS 523 S ++++ + Y +G+ D YFS+VFKK +GKSPS+Y+ ++ Sbjct: 477 SLTQKSLKEITYEIGYKDPNYFSRVFKKLTGKSPSDYRKSIN 518 Score = 54.3 bits (129), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 24/86 (27%), Positives = 48/86 (55%) Query: 24 LKLVASASSSDQALVDFHEMLPDLVVIDIGLPGMNGLELAEAFRITKPEVRLIFLTCYED 83 + +V AS+ QA+ E PDL+++DI +PG++G++ + + PE I ++ ++ Sbjct: 27 IHIVGEASNGRQAIEKALETQPDLMMMDIKMPGVDGVQAVKEIKQQLPETEFIMVSAFDT 86 Query: 84 FQYSKRAFQLEADDYLIKDELSPDQL 109 F+Y++ + +YL+K D L Sbjct: 87 FEYAREVMRYGVKEYLLKPTTKEDVL 112 >SP0661 [T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain Length = 245 Score = 73.2 bits (178), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 33/101 (32%), Positives = 63/101 (62%) Query: 1 MLIDDDVPMLEYVAHLLGSLDLELKLVASASSSDQALVDFHEMLPDLVVIDIGLPGMNGL 60 ++++D+ + + + L+ +++++ A + QA + +PD+++ DI +P +NG+ Sbjct: 6 LIVEDEYLVRQGLTKLVNVAAYDMEIIGQAENGRQAWELIQKQVPDIILTDINMPHLNGI 65 Query: 61 ELAEAFRITKPEVRLIFLTCYEDFQYSKRAFQLEADDYLIK 101 +LA R T P+V L+FLT Y+DF Y+ A +L DDYL+K Sbjct: 66 QLASLVRETYPQVHLVFLTGYDDFDYALSAVKLGVDDYLLK 106 >BH1910 [T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain Length = 506 Score = 70.1 bits (170), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 35/116 (30%), Positives = 66/116 (56%), Gaps = 1/116 (0%) Query: 1 MLIDDDVPMLEYVAHLLGSLDLELKLVASASSSDQALVDFHEMLPDLVVIDIGLPGMNGL 60 M++DD+ + E + L+ + +++ +A + + + ++ PDL+++DI +P ++GL Sbjct: 5 MIVDDEAMVREGLKALISWEEYGFRVIDTARNGKEGFTKYRQLSPDLMIVDIRMPEVDGL 64 Query: 61 ELAEAFRITKPEVRLIFLTCYEDFQYSKRAFQLEADDYLIKDELSPDQLKVSLGKA 116 L E+ R + I L+ + DF Y+K+A + DDYL+K L D+L SL K Sbjct: 65 SLIESIRAEDSAIHFIILSGHSDFNYAKKALGCQCDDYLLK-PLDEDELIDSLKKV 119 >lin1152 [K] COG2207 AraC-type DNA-binding domain-containing proteins Length = 183 Score = 68.9 bits (167), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 41/112 (36%), Positives = 67/112 (59%), Gaps = 2/112 (1%) Query: 409 TLAPTSAQGKDIRLLAIDQFLDEHVDRMITSLEMAEHLHLNASYFSRYFKKLAGVNFTDY 468 T + TS + K+I+ AI +++ +++ R IT E+A +++L+ Y S+ FK +NF +Y Sbjct: 71 TSSKTSGEHKEIKQ-AI-RYIKKNIHRSITLEEVANYVYLSPFYLSKLFKNELNINFINY 128 Query: 469 VNQYKINLAITMLSRQHETVENVAYTLGFSDRAYFSKVFKKYSGKSPSEYKN 520 VN+ K+ A L + V +A LGFS +YF KVFKK +P EY++ Sbjct: 129 VNEQKMLYAKEQLEKSDWAVHTIAKNLGFSRASYFCKVFKKEFDMTPKEYRD 180 Database: COG Posted date: Aug 3, 2010 9:58 AM Number of letters in database: 38,378,431 Number of sequences in database: 115,334 Lambda K H 0.321 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 115334 Number of Hits to DB: 36,538,835 Number of extensions: 1478141 Number of successful extensions: 3299 Number of sequences better than 1.0e-05: 133 Number of HSP's gapped: 3416 Number of HSP's successfully gapped: 142 Length of query: 530 Length of database: 38,378,431 Length adjustment: 111 Effective length of query: 419 Effective length of database: 25,576,357 Effective search space: 10716493583 Effective search space used: 10716493583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 118 (50.1 bits)