BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0284.0021.p
         (83 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BH1910 [T] COG4753 Response regulator containing CheY-like recei...    49   1e-06

>BH1910 [T] COG4753 Response regulator containing CheY-like receiver domain
           and AraC-type DNA-binding domain
          Length = 506

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 35/49 (71%), Gaps = 1/49 (2%)

Query: 35  RMEKAKLLLETTEMKIYEIADAVGYMELDWFYKKFKEYTGTSANEYRKQ 83
           R+E  K LL+    K+YE+A+ +GY  +D+F++KFK+Y G S + +RK+
Sbjct: 450 RIENGKRLLQKG-YKVYEVAEKIGYANVDYFHRKFKKYVGVSPSTFRKR 497


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.313    0.129    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 5,639,615
Number of extensions: 187584
Number of successful extensions: 1124
Number of sequences better than 1.0e-05: 3
Number of HSP's gapped: 1125
Number of HSP's successfully gapped: 3
Length of query: 83
Length of database: 38,378,431
Length adjustment: 53
Effective length of query: 30
Effective length of database: 32,265,729
Effective search space: 967971870
Effective search space used: 967971870
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 109 (46.6 bits)