BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0243.0006.p
         (348 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BH0757 [TQ] COG2508 Regulator of polyketide synthase expression        56   1e-07

>BH0757 [TQ] COG2508 Regulator of polyketide synthase expression
          Length = 557

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%)

Query: 286 DMIETLRSFINHNCSVSHTADDLNIHRNTLQYRLKRIQALTGKD 329
           D++ETL SF+NH+C +S TA  + IHRNT+ YR+K+ + + G D
Sbjct: 491 DLLETLDSFLNHHCQISETAKSMFIHRNTVIYRIKKCEEILGID 534


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.318    0.134    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 22,412,896
Number of extensions: 819735
Number of successful extensions: 1700
Number of sequences better than 1.0e-05: 4
Number of HSP's gapped: 1704
Number of HSP's successfully gapped: 4
Length of query: 348
Length of database: 38,378,431
Length adjustment: 107
Effective length of query: 241
Effective length of database: 26,037,693
Effective search space: 6275084013
Effective search space used: 6275084013
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 116 (49.3 bits)