BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0210.0002.p
         (66 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BH2055 [G] COG1501 Alpha-glucosidases, family 31 of glycosyl hyd...    77   4e-15

>BH2055 [G] COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases
          Length = 657

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 46/62 (74%)

Query: 1  MFREENGRLIREYDHERVWIEPWGEHSLRIRASYAEITDEQWALLPAVQTLSHISITKER 60
          MF+ +  RL+REYD E++WIEPWG+ +LR+RASY  I D  WALLP  +  + IS+T+E 
Sbjct: 1  MFKIDGSRLVREYDSEKLWIEPWGKDALRVRASYTAIEDTDWALLPVKEMEADISLTEET 60

Query: 61 AT 62
          AT
Sbjct: 61 AT 62


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.319    0.132    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 4,724,205
Number of extensions: 131169
Number of successful extensions: 236
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 236
Number of HSP's successfully gapped: 1
Length of query: 66
Length of database: 38,378,431
Length adjustment: 38
Effective length of query: 28
Effective length of database: 33,995,739
Effective search space: 951880692
Effective search space used: 951880692
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 109 (46.6 bits)