BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0162.0002.p
         (374 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

STM0922_1 [R] COG1310 Predicted metal-dependent protease of the ...    64   4e-10

>STM0922_1 [R] COG1310 Predicted metal-dependent protease of the PAD1/JAB1
           superfamily
          Length = 180

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%)

Query: 165 YSGIVDALLGTGSAGAPRGAYAELIAAANSSGKPIVSADIPSGLDADTGQAHEPCIHAAV 224
           +  +VDA+ GTG  G   G YAE+I   N SGK +VS D+PSG+D++TG+     + A +
Sbjct: 109 FDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADL 168

Query: 225 TVCL 228
           TV  
Sbjct: 169 TVTF 172


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.319    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 19,904,780
Number of extensions: 692883
Number of successful extensions: 1479
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 1479
Number of HSP's successfully gapped: 1
Length of query: 374
Length of database: 38,378,431
Length adjustment: 108
Effective length of query: 266
Effective length of database: 25,922,359
Effective search space: 6895347494
Effective search space used: 6895347494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 117 (49.7 bits)