BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0064.0009.p
         (75 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

lin2678 [C] COG0636 F0F1-type ATP synthase, subunit c/Archaeal/v...    70   5e-13

>lin2678 [C] COG0636 F0F1-type ATP synthase, subunit
          c/Archaeal/vacuolar-type H+-ATPase, subunit K
          Length = 64

 Score = 70.5 bits (171), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 0/41 (0%), Positives = 0/41 (0%)

Query: 29 SKTVEGIARQPEAKSTLQTTMFIGVALVEALPIIGVVLAFM 69
                                                   
Sbjct: 28                                           68


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.325    0.136    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 3,082,160
Number of extensions: 63973
Number of successful extensions: 212
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 212
Number of HSP's successfully gapped: 1
Length of query: 75
Length of database: 38,378,431
Length adjustment: 46
Effective length of query: 29
Effective length of database: 33,073,067
Effective search space: 959118943
Effective search space used: 959118943
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 109 (46.6 bits)