BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0032.0006.p
         (41 letters)

Database: COG 
           115,334 sequences; 38,378,431 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPMT1.71 [S] COG5464 Uncharacterized conserved protein                 47   5e-06

>YPMT1.71 [S] COG5464 Uncharacterized conserved protein
          Length = 328

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/38 (60%), Positives = 31/38 (81%)

Query: 3   GIKKGKIEVARNLLAMGMDHAAVAKATGLSEDEIQSIK 40
           GI+KGK+EVAR+LL MGM   +V +ATGLSED++  I+
Sbjct: 290 GIEKGKLEVARSLLKMGMPIESVQEATGLSEDDLAQIR 327


  Database: COG
    Posted date:  Aug 3, 2010  9:58 AM
  Number of letters in database: 38,378,431
  Number of sequences in database:  115,334
  
Lambda     K      H
   0.314    0.129    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 115334
Number of Hits to DB: 2,343,283
Number of extensions: 44365
Number of successful extensions: 124
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 124
Number of HSP's successfully gapped: 1
Length of query: 41
Length of database: 38,378,431
Length adjustment: 15
Effective length of query: 26
Effective length of database: 36,648,421
Effective search space: 952858946
Effective search space used: 952858946
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 109 (46.6 bits)