BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0001.4178.p
         (69 letters)

Database: BlastDatabases/707/707 
           3697 sequences; 1,221,021 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|152983329|ref|YP_001355281.1| SlyX protein [Janthinobacterium...    88   1e-19

>gi|152983329|ref|YP_001355281.1| SlyX protein [Janthinobacterium
          sp. Marseille]
          Length = 68

 Score = 87.8 bits (216), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/67 (59%), Positives = 54/67 (80%)

Query: 3  HDDRLIDIEMKIAHQEDLVDELNQTVYRQQKKIEELEMLLHALAKRFKELSDTSQDRAAA 62
          ++DR++DIE+KIA QEDL+D LNQ VY+QQKKI+ELE L  ALA+R K++     ++ AA
Sbjct: 2  NEDRIVDIEIKIARQEDLLDSLNQLVYQQQKKIDELEALCAALARRLKDVVSAGNEQNAA 61

Query: 63 NEKPPHY 69
          NE+PPHY
Sbjct: 62 NERPPHY 68


  Database: BlastDatabases/707/707
    Posted date:  Apr 13, 2011 12:58 PM
  Number of letters in database: 1,221,021
  Number of sequences in database:  3697
  
Lambda     K      H
   0.314    0.130    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3697
Number of Hits to DB: 141,775
Number of extensions: 4022
Number of successful extensions: 17
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 16
Number of HSP's successfully gapped: 1
Length of query: 69
Length of database: 1,221,021
Length adjustment: 41
Effective length of query: 28
Effective length of database: 1,069,444
Effective search space: 29944432
Effective search space used: 29944432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 122 (51.6 bits)