BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0001.3977.p
         (82 letters)

Database: BlastDatabases/707/707 
           3697 sequences; 1,221,021 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|152980262|ref|YP_001354661.1| biotin carboxyl carrier protein...    65   1e-12

>gi|152980262|ref|YP_001354661.1| biotin carboxyl carrier protein of
           acetyl-CoA carboxylase [Janthinobacterium sp. Marseille]
          Length = 154

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 4   HEVHSPLPGTFYRRSSPEAPPYAEIGDEVQAGAVIGLIEVMKQFTELQAEQGGKLIGFHI 63
           H V SP+ G+FYR S+P +P + E+G  V+ G  + +IE MK   E+ A+  G +    +
Sbjct: 79  HVVKSPMVGSFYRSSAPGSPAFVEVGSVVKEGDTLCIIEAMKLLNEIDADASGVIKEILV 138

Query: 64  ENGDPVEPGQ 73
           ENG PVE GQ
Sbjct: 139 ENGQPVEFGQ 148


  Database: BlastDatabases/707/707
    Posted date:  Apr 13, 2011 12:58 PM
  Number of letters in database: 1,221,021
  Number of sequences in database:  3697
  
Lambda     K      H
   0.314    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3697
Number of Hits to DB: 215,626
Number of extensions: 7803
Number of successful extensions: 25
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 25
Number of HSP's successfully gapped: 1
Length of query: 82
Length of database: 1,221,021
Length adjustment: 52
Effective length of query: 30
Effective length of database: 1,028,777
Effective search space: 30863310
Effective search space used: 30863310
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 122 (51.6 bits)