BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.3659.p (136 letters) Database: BlastDatabases/707/707 3697 sequences; 1,221,021 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|152980997|ref|YP_001354642.1| two-component hybrid sensor and... 73 6e-15 gi|152982173|ref|YP_001354646.1| PilG twitching motility two-com... 70 5e-14 gi|152982726|ref|YP_001353786.1| chemotaxis protein CheY [Janthi... 67 4e-13 gi|152982458|ref|YP_001353582.1| sensor histidine kinase/respons... 65 1e-12 gi|152982362|ref|YP_001353295.1| CheY chemotaxis protein [Janthi... 65 1e-12 >gi|152980997|ref|YP_001354642.1| two-component hybrid sensor and regulator [Janthinobacterium sp. Marseille] Length = 1901 Score = 73.2 bits (178), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 40/109 (36%), Positives = 60/109 (55%), Gaps = 3/109 (2%) Query: 10 VLVVEDHAESREMLCDLLRKGGLNVLAAADGVDAIALMQDHAPDLVLTDLRMPRMDGMEL 69 V+VV+D R + LL + G V+ A DGVDA+ +Q PD++L D+ MPRMDG +L Sbjct: 1779 VMVVDDSLTVRRVTQRLLTREGYQVVLAKDGVDALQHLQSVTPDVMLVDIEMPRMDGFDL 1838 Query: 70 ARYIKSHERYAQIPVVLISAHLPAASARIPM---IAAFLLKPCSVDHLF 115 R I+ ER IP+++I++ + M + +L KP D L Sbjct: 1839 TRNIRDDERTRDIPIIMITSRTASKHRNYAMELGVNEYLGKPYQEDVLL 1887 >gi|152982173|ref|YP_001354646.1| PilG twitching motility two-component system response regulator [Janthinobacterium sp. Marseille] Length = 133 Score = 70.1 bits (170), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 3/121 (2%) Query: 1 VGTNNEEQTVLVVEDHAESREMLCDLLRKGGLNVLAAADGVDAIALMQDHAPDLVLTDLR 60 + +N + ++V++D + R L + G V+ A DG DA+A M DH P L+ D+ Sbjct: 3 IALDNADMKIMVIDDSSTIRRSAEIFLGQAGYKVVLADDGFDALAKMNDHRPALIFCDIL 62 Query: 61 MPRMDGMELARYIKSHERYAQIPVVLISAHLPAAS-ARIPMIA--AFLLKPCSVDHLFGT 117 MPR+DG + IK ++ PV+++S+ AR M+ A+L KP + D L T Sbjct: 63 MPRLDGYQTCALIKKSAKFHSTPVIMLSSKDGLFDRARGAMVGSDAYLTKPFTKDSLLKT 122 Query: 118 L 118 + Sbjct: 123 V 123 >gi|152982726|ref|YP_001353786.1| chemotaxis protein CheY [Janthinobacterium sp. Marseille] Length = 121 Score = 67.0 bits (162), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 36/104 (34%), Positives = 54/104 (51%), Gaps = 3/104 (2%) Query: 8 QTVLVVEDHAESREMLCDLLRKGGLNVLAAADGVDAIALMQDHAPDLVLTDLRMPRMDGM 67 +T+L V+D R+M+ LR G V A DG D + + DLVLTD MPRMDG Sbjct: 3 KTILAVDDSGSLRQMVVFSLRAAGYQVTEAVDGQDGLDKAKTQVFDLVLTDQNMPRMDGF 62 Query: 68 ELARYIKSHERYAQIPVVLISAHLP---AASARIPMIAAFLLKP 108 L R +++ Y +IP+++++ A R +L+KP Sbjct: 63 SLIRALRALSTYQKIPILVLTTESSDEMKAKGRAAGANGWLVKP 106 >gi|152982458|ref|YP_001353582.1| sensor histidine kinase/response regulator [Janthinobacterium sp. Marseille] Length = 1096 Score = 65.5 bits (158), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 36/91 (39%), Positives = 52/91 (57%), Gaps = 3/91 (3%) Query: 1 VGTNNEEQTVLVVEDHAESREMLCDLLRKGGLNVLAAADGVDAIALMQDHAPDLVLTDLR 60 +G +T+LVV+D R ML +L G NV AA G + I L+QD PD +L D+ Sbjct: 883 IGHTGVARTLLVVDDQPVQRHMLSGMLIPLGFNVREAASGHECIDLLQDFVPDAILLDIG 942 Query: 61 MPRMDGMELARYIKSHERYAQIPVVLISAHL 91 M MDG E AR +++ + IP++ +SA L Sbjct: 943 MDGMDGWETARRVRAS---SGIPIIFVSADL 970 >gi|152982362|ref|YP_001353295.1| CheY chemotaxis protein [Janthinobacterium sp. Marseille] Length = 121 Score = 65.5 bits (158), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 35/117 (29%), Positives = 64/117 (54%), Gaps = 4/117 (3%) Query: 10 VLVVEDHAESREMLCDLLRKGGLNVLAAADGVDAIALMQ-DHAPDLVLTDLRMPRMDGME 68 +LVV+D A R + D L+K L+V+ A DG D +A M+ D + LV++D+ MP MDG+ Sbjct: 4 ILVVDDSATVRNEVGDFLKKNDLDVVLAVDGRDGLAKMKGDSSIKLVISDVNMPNMDGLT 63 Query: 69 LARYIKSHERYAQIPVVLISAH---LPAASARIPMIAAFLLKPCSVDHLFGTLTLLL 122 +A I+S + + +++++ + + I +++KP D + T L+ Sbjct: 64 MAEKIRSELGNSSVNIIMLTTENSPMMKERGKAAGIKGWIVKPFKGDAVLATFKKLV 120 Database: BlastDatabases/707/707 Posted date: Apr 13, 2011 12:58 PM Number of letters in database: 1,221,021 Number of sequences in database: 3697 Lambda K H 0.324 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3697 Number of Hits to DB: 307,024 Number of extensions: 11226 Number of successful extensions: 94 Number of sequences better than 1.0e-08: 12 Number of HSP's gapped: 102 Number of HSP's successfully gapped: 12 Length of query: 136 Length of database: 1,221,021 Length adjustment: 74 Effective length of query: 62 Effective length of database: 947,443 Effective search space: 58741466 Effective search space used: 58741466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 125 (52.8 bits)