BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.2195.p (173 letters) Database: BlastDatabases/707/707 3697 sequences; 1,221,021 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|152982215|ref|YP_001353611.1| ECF subfamily RNA polymerase si... 79 2e-16 gi|152981850|ref|YP_001353720.1| ECF subfamily RNA polymerase si... 78 4e-16 gi|152981823|ref|YP_001353717.1| ECF subfamily RNA polymerase si... 73 8e-15 gi|152981821|ref|YP_001355187.1| ECF subfamily RNA polymerase si... 72 2e-14 gi|152981879|ref|YP_001354278.1| ECF subfamily RNA polymerase si... 69 1e-13 >gi|152982215|ref|YP_001353611.1| ECF subfamily RNA polymerase sigma factor [Janthinobacterium sp. Marseille] Length = 207 Score = 78.6 bits (192), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 49/155 (31%), Positives = 80/155 (51%) Query: 14 SLHQHFIGQRQRLREAAQRILGCPYRAEDVVQDAYLKIHEVPASFDIRQPQAYLLRIVRN 73 L + + L + R L CP +A D + DA+L++ E+ + DI+ +AY+ R+ N Sbjct: 15 KLQDYLLANYSHLHKRLTRHLACPDQASDCLHDAWLRLGEMQVTEDIKNLEAYVYRVACN 74 Query: 74 LAIDHHRRSAFESDVFAAEEDGLAVHEEAQGPEAIAIGRQTLACISQALDSLPARTRRAF 133 LAID+ R S V E V ++A P+ IA R L + +AL++LP Sbjct: 75 LAIDNLRSSRPWQYVVGLENAMEYVADDALRPDQIAEVRSELQAVERALNALPRHHHDIL 134 Query: 134 ELYRLAGLSQREIAAELGVSVTLVNFLIRDALASC 168 RL L+++E+A G+S+ V+ ++R AL C Sbjct: 135 LCLRLNDLTRQEVALRHGISLRSVDTMLRQALDHC 169 >gi|152981850|ref|YP_001353720.1| ECF subfamily RNA polymerase sigma factor [Janthinobacterium sp. Marseille] Length = 173 Score = 77.8 bits (190), Expect = 4e-16, Method: Compositional matrix adjust. Identities = 52/139 (37%), Positives = 77/139 (55%), Gaps = 3/139 (2%) Query: 31 QRILGCPYRAEDVVQDAYLKIHEVP-ASFDIRQPQAYLLRIVRNLAIDHHRRSAFESDVF 89 ++ +GC ++A D+ DA+L+I P A D+R+P+AYL I R L + RR E + Sbjct: 30 RKKMGCTHQAADLAHDAFLQILGRPEALVDVREPRAYLTTIARRLVFESWRRRDLEQ-AY 88 Query: 90 AAEEDGLAVHEEAQGPEAIAIGRQTLACISQALDSLPARTRRAFELYRLAGLSQREIAAE 149 AE L + A PE A+ +TL I + LD L + R AF + +L G++ EIAAE Sbjct: 89 LAELAALP-EDVAPSPEDQALVLETLLAIDRLLDGLSVKARSAFLMSQLDGMTYSEIAAE 147 Query: 150 LGVSVTLVNFLIRDALASC 168 L VS + V + AL+ C Sbjct: 148 LNVSASRVRQYMAQALSCC 166 >gi|152981823|ref|YP_001353717.1| ECF subfamily RNA polymerase sigma factor [Janthinobacterium sp. Marseille] Length = 186 Score = 73.2 bits (178), Expect = 8e-15, Method: Compositional matrix adjust. Identities = 51/144 (35%), Positives = 72/144 (50%), Gaps = 8/144 (5%) Query: 31 QRILGCPYRAEDVVQDAYLKIHEVPASFDIRQ-PQAYLLRIVRNLAIDHHRRSAFESDVF 89 ++ L CP+ A D QD + ++ VP Q P+AYL L ID RR E Sbjct: 38 RKKLACPHSAADFAQDTFFRLLSVPFELTTLQTPRAYLTTTATRLMIDETRRRKVEQ--- 94 Query: 90 AAEEDGLAVHEE---AQGPEAIAIGRQTLACISQALDSLPARTRRAFELYRLAGLSQREI 146 A + LA+ ++ + PE +TL I++ L+ LP + R+AF L RL LS EI Sbjct: 95 -AYLEALALLQDEVYSVSPEQHLETVETLTLIARMLEDLPEKPRQAFMLSRLDNLSYPEI 153 Query: 147 AAELGVSVTLVNFLIRDALASCRQ 170 A LGVS ++V I A+ C Q Sbjct: 154 AMRLGVSASMVKQYIARAMVHCYQ 177 >gi|152981821|ref|YP_001355187.1| ECF subfamily RNA polymerase sigma factor [Janthinobacterium sp. Marseille] Length = 184 Score = 71.6 bits (174), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 50/157 (31%), Positives = 75/157 (47%), Gaps = 5/157 (3%) Query: 15 LHQHFIGQRQRLREAAQRILGCPYRAEDVVQDAYLKI---HEVPASFDIRQPQAYLLRIV 71 +H + L ++ LGC + A D+ QD +L+I + + D+R+P+AYL + Sbjct: 25 IHTLYSNHHGWLFGWLRKKLGCAHNAADIAQDTFLRILTAQDKRSDLDLREPRAYLTTVA 84 Query: 72 RNLAIDHHRRSAFESDVFAAEEDGLAVHEEAQGPEAIAIGRQTLACISQALDSLPARTRR 131 + ++H+RR + E E L A PE I +TL I LD+LP + R Sbjct: 85 GRVLLNHYRRLSLERAYL--EALALVPDMYAPAPEDRLIILETLHEIDAMLDALPHKART 142 Query: 132 AFELYRLAGLSQREIAAELGVSVTLVNFLIRDALASC 168 AF L + GLS EI+ L VSV V + A C Sbjct: 143 AFLLAQFEGLSYAEISVRLDVSVRTVKRYMAQAFEEC 179 >gi|152981879|ref|YP_001354278.1| ECF subfamily RNA polymerase sigma factor [Janthinobacterium sp. Marseille] Length = 181 Score = 69.3 bits (168), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 49/137 (35%), Positives = 68/137 (49%), Gaps = 6/137 (4%) Query: 34 LGCPYRAEDVVQDAYLKIHEVPASFDIRQPQAYLLRIVRNLAIDHHRRSAFESDVFAAEE 93 LG + A D+ D +L++ IR+P+A L I + + + +RR E A Sbjct: 43 LGNSFDAADLAHDTFLRVLTKDVPLAIREPRALLTTIAQGMVANLYRRRQIEQ----AYL 98 Query: 94 DGLAVHEEAQG--PEAIAIGRQTLACISQALDSLPARTRRAFELYRLAGLSQREIAAELG 151 D LAV E+ PEA AI +TL I + LD L R+ F L +L GL Q EIA L Sbjct: 99 DALAVLPESHAISPEARAIMLETLVEIDRLLDGLAPLVRKVFLLSQLDGLGQAEIAERLA 158 Query: 152 VSVTLVNFLIRDALASC 168 +S+ V I A+A C Sbjct: 159 ISIPTVKRYIAKAVAQC 175 Database: BlastDatabases/707/707 Posted date: Apr 13, 2011 12:58 PM Number of letters in database: 1,221,021 Number of sequences in database: 3697 Lambda K H 0.325 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3697 Number of Hits to DB: 371,525 Number of extensions: 13684 Number of successful extensions: 104 Number of sequences better than 1.0e-08: 16 Number of HSP's gapped: 93 Number of HSP's successfully gapped: 16 Length of query: 173 Length of database: 1,221,021 Length adjustment: 77 Effective length of query: 96 Effective length of database: 936,352 Effective search space: 89889792 Effective search space used: 89889792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 126 (53.1 bits)