BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0001.1838.p
         (65 letters)

Database: BlastDatabases/707/707 
           3697 sequences; 1,221,021 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|152983158|ref|YP_001353179.1| 50S ribosomal subunit protein A...   119   4e-29

>gi|152983158|ref|YP_001353179.1| 50S ribosomal subunit protein A
          [Janthinobacterium sp. Marseille]
          Length = 76

 Score =  119 bits (297), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 58/65 (89%), Positives = 62/65 (95%)

Query: 1  MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60
          MPKMK+KSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRG  GVH+TN+NSVRA
Sbjct: 12 MPKMKTKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGAVGVHDTNMNSVRA 71

Query: 61 MLPFA 65
          M+P A
Sbjct: 72 MMPNA 76


  Database: BlastDatabases/707/707
    Posted date:  Apr 13, 2011 12:58 PM
  Number of letters in database: 1,221,021
  Number of sequences in database:  3697
  
Lambda     K      H
   0.317    0.129    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3697
Number of Hits to DB: 110,904
Number of extensions: 2602
Number of successful extensions: 4
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 4
Number of HSP's successfully gapped: 1
Length of query: 65
Length of database: 1,221,021
Length adjustment: 37
Effective length of query: 28
Effective length of database: 1,084,232
Effective search space: 30358496
Effective search space used: 30358496
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 122 (51.6 bits)