BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0001.1489.p
         (66 letters)

Database: BlastDatabases/707/707 
           3697 sequences; 1,221,021 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|152983327|ref|YP_001355218.1| heavy metal transport/detoxific...    52   9e-09

>gi|152983327|ref|YP_001355218.1| heavy metal
          transport/detoxification protein [Janthinobacterium sp.
          Marseille]
          Length = 68

 Score = 51.6 bits (122), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 5  FTVNDMTCNHCAGVITKAVKDVDANAKVDITVADKRVVIDSSLPAQSFAEAIEEAGYTPV 64
            V DM+C HC   +TK V  VDA AKV++ +   +V + S+      AEAI EAGY PV
Sbjct: 4  LKVEDMSCGHCVSKVTKTVIGVDAAAKVEVDLTQGKVRVQSNADLAEIAEAITEAGY-PV 62

Query: 65 AA 66
           A
Sbjct: 63 TA 64


  Database: BlastDatabases/707/707
    Posted date:  Apr 13, 2011 12:58 PM
  Number of letters in database: 1,221,021
  Number of sequences in database:  3697
  
Lambda     K      H
   0.315    0.125    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3697
Number of Hits to DB: 131,646
Number of extensions: 3644
Number of successful extensions: 21
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 21
Number of HSP's successfully gapped: 1
Length of query: 66
Length of database: 1,221,021
Length adjustment: 38
Effective length of query: 28
Effective length of database: 1,080,535
Effective search space: 30254980
Effective search space used: 30254980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 122 (51.6 bits)