BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.1207.p (186 letters) Database: BlastDatabases/707/707 3697 sequences; 1,221,021 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|152980789|ref|YP_001354207.1| pseudouridylate synthase family... 276 6e-76 gi|152981396|ref|YP_001353640.1| ribosomal small subunit pseudou... 77 5e-16 gi|152981336|ref|YP_001353751.1| pseudouridylate synthase [Janth... 64 6e-12 gi|152981088|ref|YP_001354188.1| ribosomal large subunit pseudou... 63 1e-11 >gi|152980789|ref|YP_001354207.1| pseudouridylate synthase family protein [Janthinobacterium sp. Marseille] Length = 211 Score = 276 bits (706), Expect = 6e-76, Method: Compositional matrix adjust. Identities = 131/184 (71%), Positives = 149/184 (80%) Query: 1 MSLILLNKPFGVMSQFSTHPQRQTLADYLDIPGIYPAGRLDADSEGLLLLTDDGKLQHAI 60 M LIL NKPF M QFS HP R++LAD++DIP IYPAGRLDADSEGLLLL DDGKLQHAI Sbjct: 25 MPLILFNKPFQTMCQFSPHPTRKSLADHIDIPNIYPAGRLDADSEGLLLLNDDGKLQHAI 84 Query: 61 AHPRRKQPKTYLAQVEGLASPQALQRLRDPLDLGDFVTQPSDAKLIQEPAWLWPRNPPIR 120 +HP RK KTYL QVEG+ AL RLR PLDLGDFVTQ + K + EP WLWPRNPPIR Sbjct: 85 SHPDRKHTKTYLVQVEGVPDADALARLRAPLDLGDFVTQECEVKRVAEPDWLWPRNPPIR 144 Query: 121 QRQHLPTSWIALTISEGKNRQVRRMTAAVGLPTLRLIRIAIGPFSLATHPVMPGEWRQVD 180 +R + PTSW+A+T+SEGKNRQVRRMT AVG PTLRL+RIAIGP SL +HP+ PGEWR++ Sbjct: 145 ERANAPTSWLAITLSEGKNRQVRRMTGAVGYPTLRLVRIAIGPVSLQSHPLWPGEWREIS 204 Query: 181 PLEL 184 EL Sbjct: 205 VAEL 208 >gi|152981396|ref|YP_001353640.1| ribosomal small subunit pseudouridine synthase A protein [Janthinobacterium sp. Marseille] Length = 238 Score = 77.4 bits (189), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 58/176 (32%), Positives = 86/176 (48%), Gaps = 20/176 (11%) Query: 4 ILLNKP--FGVMSQFSTHPQRQTLA-DYLDIPGIYPAGRLDADSEGLLLLTDDGKLQHAI 60 I+LNKP F + S HP TL + + P GRLD D+ G+LL++DDG HA Sbjct: 66 IVLNKPANFECSRKPSHHPGVLTLLPEQFTWRELQPVGRLDHDTTGMLLMSDDGPFIHAQ 125 Query: 61 AHPRRKQPKTYLAQVEGLASPQALQRLRDPLDLGDFVTQPSDAKLIQEPAWLWPRNPPIR 120 + P+R PK Y+A +P+ + +L + L D EPA L + + Sbjct: 126 SSPKRHIPKVYVATTHDPVTPELIAQLLGGVQLHD------------EPAPLAAQTCRM- 172 Query: 121 QRQHLPTSWIALTISEGKNRQVRRMTAAVGLPTLRLIRIAIGPFSLATHPVMPGEW 176 L + + + + +GK QV+RM AA G L R+AIG +L + + GEW Sbjct: 173 ----LGANELEIVLEQGKYHQVKRMLAAAGNHCSALRRVAIGALTLESLELDEGEW 224 >gi|152981336|ref|YP_001353751.1| pseudouridylate synthase [Janthinobacterium sp. Marseille] Length = 248 Score = 63.9 bits (154), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 57/195 (29%), Positives = 79/195 (40%), Gaps = 42/195 (21%) Query: 4 ILLNKPFGVMSQFS-----------------THPQRQTLADYLDIPGIYPAGRLDADSEG 46 +L+NKP G +S + + Q T + + PAGRLD DS G Sbjct: 67 VLINKPMGYVSGQAEDGYKPAVALVNASTRWSEDQAATQFHPTQLRSLVPAGRLDIDSVG 126 Query: 47 LLLLTDDGKLQHAIAHPRRKQPKTYLAQVE----GLASPQALQRLRDPLDLGDFVTQPSD 102 LL+LT DG++ + K YL +V+ G L+RL L L P+ Sbjct: 127 LLVLTQDGRIAKHLIGEDTSVEKEYLVRVQYSKPGKLPEADLKRLNHGLMLDGKKLLPAK 186 Query: 103 AKLIQEPAWLWPRNPPIRQRQHLPTSWIALTISEGKNRQVRRMTAAVGLPTLRLIRIAIG 162 K E ++ + EGK RQ+RRM VGL + L R+ IG Sbjct: 187 VKWQNEDQ-------------------LSFILREGKKRQIRRMCDMVGLKVIGLKRVRIG 227 Query: 163 PFSLATHPVMPGEWR 177 L PV G+WR Sbjct: 228 NVKLGDLPV--GQWR 240 >gi|152981088|ref|YP_001354188.1| ribosomal large subunit pseudouridine synthase B [Janthinobacterium sp. Marseille] Length = 546 Score = 63.2 bits (152), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 54/178 (30%), Positives = 80/178 (44%), Gaps = 23/178 (12%) Query: 3 LILLNKPFGVMSQFSTHPQRQTLADYLDIPGIYPAGRLDADSEGLLLLTDDGKLQHAIAH 62 ++ N P G S F P + A +L + GRLD ++EGLLL T G L + + H Sbjct: 257 IVSTNDPEGRPSVFDRLPTMKA-AKWLAV------GRLDFNTEGLLLFTTSGDLANRLMH 309 Query: 63 PRRKQPKTYLAQVEGLASPQALQRLRDPLDLGDFVTQPSDAKLIQEPAWLWPRNPPIRQR 122 PR + Y + G Q+L ++L D + Q S K+ Sbjct: 310 PRYGIDREYAVRTLGELEEGMRQKLLAGVELEDGLAQFS--KIADGGG------------ 355 Query: 123 QHLPTSWIALTISEGKNRQVRRMTAAVGLPTLRLIRIAIGPFSLATHPVMPGEWRQVD 180 W +TI EG+NR+VRRM A+GL RLIR G +L + + G W +++ Sbjct: 356 -EGVNKWYRVTIGEGRNREVRRMFEAIGLTVSRLIRTRYGLLTLPKN-LKRGRWEEME 411 Database: BlastDatabases/707/707 Posted date: Apr 13, 2011 12:58 PM Number of letters in database: 1,221,021 Number of sequences in database: 3697 Lambda K H 0.320 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3697 Number of Hits to DB: 478,654 Number of extensions: 19968 Number of successful extensions: 65 Number of sequences better than 1.0e-08: 4 Number of HSP's gapped: 63 Number of HSP's successfully gapped: 4 Length of query: 186 Length of database: 1,221,021 Length adjustment: 78 Effective length of query: 108 Effective length of database: 932,655 Effective search space: 100726740 Effective search space used: 100726740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 127 (53.5 bits)