BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.1179.p (264 letters) Database: BlastDatabases/707/707 3697 sequences; 1,221,021 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|152982513|ref|YP_001353581.1| LuxR family transcriptional reg... 89 3e-19 gi|152982489|ref|YP_001354645.1| twitching motility two-componen... 86 2e-18 gi|152981322|ref|YP_001355016.1| two components system response ... 78 5e-16 gi|152980997|ref|YP_001354642.1| two-component hybrid sensor and... 75 4e-15 gi|152981318|ref|YP_001352484.1| response regulator of copper se... 72 3e-14 >gi|152982513|ref|YP_001353581.1| LuxR family transcriptional regulator [Janthinobacterium sp. Marseille] Length = 313 Score = 89.0 bits (219), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 47/116 (40%), Positives = 66/116 (56%) Query: 19 ILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVYDGLTS 78 +L+VDDA +L + L G + VA DG R+ V PD+ILMD MP G + Sbjct: 17 VLLVDDAPSSLGVLCETLEGAGYTVLVACDGDTALRRLSLVTPDVILMDAVMPGISGFDA 76 Query: 79 CRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEVRLRLCVHL 134 CR +KA+ ST++IP+IF++ + T + G + G VDY+ KP EV RL HL Sbjct: 77 CRRIKADLSTKHIPVIFMTGLSDTSHVLEGFACGGVDYVVKPVRAPEVLARLHTHL 132 >gi|152982489|ref|YP_001354645.1| twitching motility two-component response regulator transcription regulator protein [Janthinobacterium sp. Marseille] Length = 121 Score = 85.9 bits (211), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 42/113 (37%), Positives = 67/113 (59%) Query: 14 LAGQRILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVY 73 +A Q+ILVVDD+ +R L+D L++ G + A +G++ K + +P LILMDI MP Sbjct: 1 MAIQKILVVDDSPTERYFLTDILIKRGFSVSTAENGEEALLKIKADKPQLILMDIVMPGQ 60 Query: 74 DGLTSCRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEV 126 +G R + + T+++P+I ++ ++I GL GA DYI KP D E+ Sbjct: 61 NGFQVTRSITRDPETQDVPIIICTSKGQETDRIWGLRQGARDYIVKPVDPAEL 113 >gi|152981322|ref|YP_001355016.1| two components system response regulator [Janthinobacterium sp. Marseille] Length = 246 Score = 78.2 bits (191), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 50/135 (37%), Positives = 74/135 (54%), Gaps = 4/135 (2%) Query: 19 ILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVYDGLTS 78 IL+VDD E R LL+ +L ++G R +A +G+ + DLI++D+ +P DGLT Sbjct: 7 ILIVDDDREIRELLASYLEKNGMRTSLAANGRQMRTVLEQGSVDLIVLDLMLPGEDGLTL 66 Query: 79 CRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEVRLRLCVHLRTPL 138 CR L+A R IP++ L+A ++I GL GA DY++KPF E+ R+ LR Sbjct: 67 CRELRA-GKWRTIPVLMLTARNEETDRIIGLEMGADDYLSKPFAVRELFARIRSVLR--- 122 Query: 139 HSEPLPATTTSVTPG 153 + LPA P Sbjct: 123 RARMLPANLQVSEPA 137 >gi|152980997|ref|YP_001354642.1| two-component hybrid sensor and regulator [Janthinobacterium sp. Marseille] Length = 1901 Score = 75.1 bits (183), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 38/113 (33%), Positives = 67/113 (59%), Gaps = 1/113 (0%) Query: 19 ILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVYDGLTS 78 ++VVDD+ R + L R G ++ +A+DG D + Q+V PD++L+DI MP DG Sbjct: 1779 VMVVDDSLTVRRVTQRLLTREGYQVVLAKDGVDALQHLQSVTPDVMLVDIEMPRMDGFDL 1838 Query: 79 CRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEVRLRLC 131 R ++ + TR+IP+I +++ A++ + + G +Y+ KP+ E+V L L Sbjct: 1839 TRNIRDDERTRDIPIIMITSRTASKHRNYAMELGVNEYLGKPYQ-EDVLLELI 1890 >gi|152981318|ref|YP_001352484.1| response regulator of copper sensing system [Janthinobacterium sp. Marseille] Length = 227 Score = 72.4 bits (176), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 6/133 (4%) Query: 18 RILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVYDGLT 77 +ILVV+D + + L G + VAR+G DG+ A DL+L+D+ +P DG Sbjct: 2 KILVVEDENKTADYIRQGLREAGFVVDVARNGLDGHHMAMNEAYDLVLLDVMLPDVDGWH 61 Query: 78 SCRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEVRLRLCVHLRTP 137 + L+ + +P++FL+A + ++++ GL GA Y+ KPF F E L H+RT Sbjct: 62 IVKSLR--DAGHQVPVLFLTARGSVDDRVKGLELGADSYLIKPFAFSE----LLAHVRTL 115 Query: 138 LHSEPLPATTTSV 150 L +PA + + Sbjct: 116 LRRRNVPAQSDQL 128 Database: BlastDatabases/707/707 Posted date: Apr 13, 2011 12:58 PM Number of letters in database: 1,221,021 Number of sequences in database: 3697 Lambda K H 0.323 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3697 Number of Hits to DB: 581,304 Number of extensions: 22807 Number of successful extensions: 172 Number of sequences better than 1.0e-08: 33 Number of HSP's gapped: 161 Number of HSP's successfully gapped: 33 Length of query: 264 Length of database: 1,221,021 Length adjustment: 82 Effective length of query: 182 Effective length of database: 917,867 Effective search space: 167051794 Effective search space used: 167051794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 128 (53.9 bits)