BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.1171.p (141 letters) Database: BlastDatabases/707/707 3697 sequences; 1,221,021 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|152982609|ref|YP_001351719.1| hypothetical protein mma_0029 [... 97 5e-22 gi|152981055|ref|YP_001351702.1| response regulator/GGDEF domain... 87 4e-19 gi|152980290|ref|YP_001353520.1| hypothetical protein mma_1830 [... 72 2e-14 gi|152982877|ref|YP_001352253.1| hypothetical protein mma_0563 [... 71 3e-14 gi|152982153|ref|YP_001353313.1| diguanylate cyclase [Janthinoba... 68 2e-13 >gi|152982609|ref|YP_001351719.1| hypothetical protein mma_0029 [Janthinobacterium sp. Marseille] Length = 313 Score = 96.7 bits (239), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 45/122 (36%), Positives = 80/122 (65%), Gaps = 1/122 (0%) Query: 6 NLMKLALQHASRSESALSLVMFDVDFFKKYNDLYGHIQGDYCPQDIARTVRSAQRCHGDL 65 ++++L +A S+ LS+++ D+D+FK+YND YGHIQGD+C + +A+T+ +A D Sbjct: 163 SVLELEWANAMNSKRPLSIILLDIDYFKQYNDHYGHIQGDHCLKQVAKTLNNAAIRQRDF 222 Query: 66 AARYGGEEFVLLLPDTDLAGAHRLAQKVVDDVRALKIPYEGNAAG-VVTLSARVASCVPR 124 R+GGEEF+L+LP+T+ A +A++ + +IP+E +A ++T+S V + +P Sbjct: 223 FGRFGGEEFILILPETNEKSALTVAERCRMLIFKEQIPHEKSAVSQLLTISLGVHTVIPS 282 Query: 125 AG 126 G Sbjct: 283 YG 284 >gi|152981055|ref|YP_001351702.1| response regulator/GGDEF domain-containing protein [Janthinobacterium sp. Marseille] Length = 341 Score = 87.0 bits (214), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 46/114 (40%), Positives = 70/114 (61%), Gaps = 1/114 (0%) Query: 13 QHASRSESALSLVMFDVDFFKKYNDLYGHIQGDYCPQDIARTVRSAQRCHGDLAARYGGE 72 + A R + LS+++ DVD FK YND YGH+ GD + +A+++ ++ DL+AR+GGE Sbjct: 197 KRARREQQELSILLIDVDNFKLYNDTYGHVAGDLVLKQVAKSLEASAMRPADLSARFGGE 256 Query: 73 EFVLLLPDTDLAGAHRLAQKVVDDVRALKIPYEGNAAG-VVTLSARVASCVPRA 125 EF ++LP T GA +KV V AL+IP+ A G +T+S A+ P+A Sbjct: 257 EFAIILPATGSNGAVISGKKVCAAVEALRIPHAHAAIGEWLTVSVGAATITPQA 310 >gi|152980290|ref|YP_001353520.1| hypothetical protein mma_1830 [Janthinobacterium sp. Marseille] Length = 417 Score = 71.6 bits (174), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Query: 22 LSLVMFDVDFFKKYNDLYGHIQGDYCPQDIARTVRSAQRCHGDLAARYGGEEFVLLLPDT 81 LSL++ D+D FK+ ND YGH GD ++ AR R++ R GD R GGEEF +LLP+T Sbjct: 276 LSLLIIDLDHFKRINDTYGHAGGDEVLREFARMTRASLR-DGDALGRLGGEEFGILLPNT 334 Query: 82 DLAGAHRLAQKVVDD 96 D GA +A+++ +D Sbjct: 335 DTVGALAIARRLRED 349 >gi|152982877|ref|YP_001352253.1| hypothetical protein mma_0563 [Janthinobacterium sp. Marseille] Length = 321 Score = 70.9 bits (172), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 34/91 (37%), Positives = 57/91 (62%), Gaps = 1/91 (1%) Query: 8 MKLALQHASRSESALSLVMFDVDFFKKYNDLYGHIQGDYCPQDIARTVRSAQRCHGDLAA 67 + + ++ A + LSL+M D+D FK++ND YGH+ GD + A + +A R D A Sbjct: 178 LSVLVEEAHAGKRPLSLIMIDLDHFKRFNDEYGHLLGDTALRTAAGVLSAALRP-SDFAV 236 Query: 68 RYGGEEFVLLLPDTDLAGAHRLAQKVVDDVR 98 RYGGEE +++LPD++ A +AQ++ + +R Sbjct: 237 RYGGEELIVILPDSNGAAGTMVAQRLCERMR 267 >gi|152982153|ref|YP_001353313.1| diguanylate cyclase [Janthinobacterium sp. Marseille] Length = 605 Score = 68.2 bits (165), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 38/98 (38%), Positives = 54/98 (55%), Gaps = 1/98 (1%) Query: 10 LALQHASRSESALSLVMFDVDFFKKYNDLYGHIQGDYCPQDIARTVRSAQRCHGDLAARY 69 L R LS++ FD+D FK+ ND YGH GD + AR R+A R D AR Sbjct: 465 LEFAKVRRLHQPLSVISFDIDLFKQINDNYGHAAGDEVIKAAARVSRNAVR-EIDFVARI 523 Query: 70 GGEEFVLLLPDTDLAGAHRLAQKVVDDVRALKIPYEGN 107 GGEEF +LLP + + A A+++ + V A ++ Y+G Sbjct: 524 GGEEFAILLPGSTIEQAAATAERLRELVIAEQVSYQGK 561 Database: BlastDatabases/707/707 Posted date: Apr 13, 2011 12:58 PM Number of letters in database: 1,221,021 Number of sequences in database: 3697 Lambda K H 0.322 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3697 Number of Hits to DB: 304,567 Number of extensions: 11061 Number of successful extensions: 86 Number of sequences better than 1.0e-08: 19 Number of HSP's gapped: 74 Number of HSP's successfully gapped: 19 Length of query: 141 Length of database: 1,221,021 Length adjustment: 74 Effective length of query: 67 Effective length of database: 947,443 Effective search space: 63478681 Effective search space used: 63478681 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 125 (52.8 bits)