BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0001.4619.p
         (109 letters)

Database: BlastDatabases/690/690 
           3295 sequences; 1,000,347 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|134095592|ref|YP_001100667.1| hypothetical protein HEAR2415 [...    54   3e-09

>gi|134095592|ref|YP_001100667.1| hypothetical protein HEAR2415
           [Herminiimonas arsenicoxydans]
          Length = 149

 Score = 53.5 bits (127), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%)

Query: 36  GAYIDDSVITAKVKAALLEDKQVSAMKIKVTTKDGVVTLKGSVPTTELGQHALQLVAGVE 95
           G  IDD+VIT KVK ALL D  +  + + V T  GVVTL G+V        A ++    E
Sbjct: 76  GTIIDDTVITTKVKTALLADSDIKGLDVNVDTSHGVVTLSGAVSNQTQIDRAGKIAGDTE 135

Query: 96  GVRDVKSELTVR 107
           GV  + + LT++
Sbjct: 136 GVASIINNLTIK 147


  Database: BlastDatabases/690/690
    Posted date:  Apr 9, 2011  4:48 AM
  Number of letters in database: 1,000,347
  Number of sequences in database:  3295
  
Lambda     K      H
   0.313    0.126    0.326 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3295
Number of Hits to DB: 172,279
Number of extensions: 5396
Number of successful extensions: 36
Number of sequences better than 1.0e-08: 2
Number of HSP's gapped: 37
Number of HSP's successfully gapped: 2
Length of query: 109
Length of database: 1,000,347
Length adjustment: 69
Effective length of query: 40
Effective length of database: 772,992
Effective search space: 30919680
Effective search space used: 30919680
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 122 (51.6 bits)