BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0001.4178.p
         (69 letters)

Database: BlastDatabases/690/690 
           3295 sequences; 1,000,347 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|134096519|ref|YP_001101594.1| hypothetical protein HEAR3371 [...    80   2e-17

>gi|134096519|ref|YP_001101594.1| hypothetical protein HEAR3371
          [Herminiimonas arsenicoxydans]
          Length = 68

 Score = 80.1 bits (196), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 51/67 (76%)

Query: 3  HDDRLIDIEMKIAHQEDLVDELNQTVYRQQKKIEELEMLLHALAKRFKELSDTSQDRAAA 62
          ++DR+++IE+K+  QEDLVD LN+ VY QQKKI ELE L  ALA R KE++    ++ +A
Sbjct: 2  NEDRIVEIEIKLTRQEDLVDILNKMVYEQQKKITELEALCIALAGRLKEVASGGNEQGSA 61

Query: 63 NEKPPHY 69
          +E+PPHY
Sbjct: 62 HERPPHY 68


  Database: BlastDatabases/690/690
    Posted date:  Apr 9, 2011  4:48 AM
  Number of letters in database: 1,000,347
  Number of sequences in database:  3295
  
Lambda     K      H
   0.314    0.130    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3295
Number of Hits to DB: 118,104
Number of extensions: 3340
Number of successful extensions: 11
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 11
Number of HSP's successfully gapped: 1
Length of query: 69
Length of database: 1,000,347
Length adjustment: 40
Effective length of query: 29
Effective length of database: 868,547
Effective search space: 25187863
Effective search space used: 25187863
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 121 (51.2 bits)