BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0001.1924.p
         (119 letters)

Database: BlastDatabases/690/690 
           3295 sequences; 1,000,347 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|134095067|ref|YP_001100142.1| hypothetical protein HEAR1867 [...    69   5e-14

>gi|134095067|ref|YP_001100142.1| hypothetical protein HEAR1867
           [Herminiimonas arsenicoxydans]
          Length = 112

 Score = 69.3 bits (168), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 52/73 (71%)

Query: 47  ESEVNDAVGKLNDFAAANAAALNFSKDQDTGKTIIKVVDTATDKVIRQIPSEEAIAIAKS 106
           E++++DAV +LN    + +  L FS D ++ +++++++D  T  +IRQ+PS EA+ IA +
Sbjct: 40  ETQLHDAVTRLNQAMQSMSPGLEFSIDPESQRSVVRIIDQTTGDLIRQMPSAEALEIASA 99

Query: 107 IDKMQGLLIKEKA 119
           +DKMQG+LI  +A
Sbjct: 100 LDKMQGVLISLRA 112


  Database: BlastDatabases/690/690
    Posted date:  Apr 9, 2011  4:48 AM
  Number of letters in database: 1,000,347
  Number of sequences in database:  3295
  
Lambda     K      H
   0.308    0.123    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3295
Number of Hits to DB: 198,513
Number of extensions: 6464
Number of successful extensions: 26
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 26
Number of HSP's successfully gapped: 1
Length of query: 119
Length of database: 1,000,347
Length adjustment: 71
Effective length of query: 48
Effective length of database: 766,402
Effective search space: 36787296
Effective search space used: 36787296
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 123 (52.0 bits)