BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.1834.p (135 letters) Database: BlastDatabases/690/690 3295 sequences; 1,000,347 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|134094532|ref|YP_001099607.1| chemotactic response regulator ... 159 6e-41 gi|134094525|ref|YP_001099600.1| chemotactic response regulator ... 77 3e-16 gi|134094343|ref|YP_001099418.1| response regulator [Herminiimon... 62 1e-11 gi|134093754|ref|YP_001098829.1| two-component regulatory system... 60 4e-11 gi|134095906|ref|YP_001100981.1| putative composite two componen... 58 2e-10 >gi|134094532|ref|YP_001099607.1| chemotactic response regulator [Herminiimonas arsenicoxydans] Length = 132 Score = 159 bits (401), Expect = 6e-41, Method: Compositional matrix adjust. Identities = 79/130 (60%), Positives = 98/130 (75%), Gaps = 2/130 (1%) Query: 1 MAADDQYFLVVDDFSTMRRIVSGLLKELEYTKMVEADDGSTAMKILEAGAVPISFVLTDW 60 MA + FLVVDDFSTMRRIV LLKEL YT + EA+DG A+ L + FV++DW Sbjct: 1 MAGPNTKFLVVDDFSTMRRIVRNLLKELGYTNVDEAEDGVMALSKLRSET--FDFVVSDW 58 Query: 61 NMPVMDGLALLKKIRSTPSLAHLPVLMITAEAKKENIVVAAQAGADGYIVKPFNAVTLKE 120 NMP MDGL +L++IR+ P+L+ LPVLM+TAEAKKENI+ AAQAGA+GY+VKPF A TL E Sbjct: 59 NMPNMDGLTMLQQIRADPALSKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATLDE 118 Query: 121 KIEKILARRA 130 K+ KI + A Sbjct: 119 KLAKIFEKLA 128 >gi|134094525|ref|YP_001099600.1| chemotactic response regulator [Herminiimonas arsenicoxydans] Length = 121 Score = 77.0 bits (188), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 42/119 (35%), Positives = 70/119 (58%), Gaps = 3/119 (2%) Query: 9 LVVDDFSTMRRIVSGLLKELEYTKMVEADDGSTAMKILEAGAVPISFVLTDWNMPVMDGL 68 L VDD ++R++V L+ Y ++ EA DG + +A VLTD NMP MDG Sbjct: 6 LAVDDSGSLRQMVVFSLRAAGY-QVTEAVDGQDGLD--KAQMQVFDLVLTDQNMPRMDGF 62 Query: 69 ALLKKIRSTPSLAHLPVLMITAEAKKENIVVAAQAGADGYIVKPFNAVTLKEKIEKILA 127 +L++ +R+ P+ +P+L++T E+ E AGA+G++VKPF+ L E ++K++ Sbjct: 63 SLIRALRALPTYQKVPILVLTTESSDEMKAKGRAAGANGWLVKPFDPQRLTEVVKKVIG 121 >gi|134094343|ref|YP_001099418.1| response regulator [Herminiimonas arsenicoxydans] Length = 229 Score = 61.6 bits (148), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 3/129 (2%) Query: 1 MAADDQYFLVVDDFSTMRRIVSGLLKELEYTKMVEADDGSTAMKILEAGAVPISFVLTDW 60 MAA+ L+V+D + +V+ LK + + A ++ +P +L DW Sbjct: 1 MAAEKPTILIVEDEPPIIELVTFTLKGAGWN-VTAVQTAGEAWDFIQQ-RLP-QLILLDW 57 Query: 61 NMPVMDGLALLKKIRSTPSLAHLPVLMITAEAKKENIVVAAQAGADGYIVKPFNAVTLKE 120 +P GL LL +IR+ LP++M+TA++ +E+ + GAD Y+ KPF+ L Sbjct: 58 MLPDQSGLRLLSRIRADRQFNELPIIMLTAKSMEEDKIAGLDNGADDYVTKPFSPRELTA 117 Query: 121 KIEKILARR 129 +I +L R+ Sbjct: 118 RINALLRRK 126 >gi|134093754|ref|YP_001098829.1| two-component regulatory system response regulator [Herminiimonas arsenicoxydans] Length = 229 Score = 60.1 bits (144), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 26/78 (33%), Positives = 45/78 (57%) Query: 52 PISFVLTDWNMPVMDGLALLKKIRSTPSLAHLPVLMITAEAKKENIVVAAQAGADGYIVK 111 P +L DW +P GL LL ++R + LP++M+TA++ +E+ V + GAD Y+ K Sbjct: 49 PPHLILLDWMLPDQSGLQLLSRVRESRQFRGLPIIMLTAKSMEEDKVTGLENGADDYVTK 108 Query: 112 PFNAVTLKEKIEKILARR 129 PF+ L ++ +L + Sbjct: 109 PFSPRELIARVTVLLKHK 126 >gi|134095906|ref|YP_001100981.1| putative composite two component regulatory (sensor histidine kinase and response regulator hybrid) transcription regulator protein [Herminiimonas arsenicoxydans] Length = 1969 Score = 58.2 bits (139), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 37/110 (33%), Positives = 58/110 (52%), Gaps = 3/110 (2%) Query: 9 LVVDDFSTMRRIVSGLLKELEYTKMVEADDGSTAMKILEAGAVPISFVLTDWNMPVMDGL 68 +VVDD T+RR+ LL Y ++V A DG A++ L++ V +L D MP MDG Sbjct: 1848 MVVDDSLTVRRVTQRLLTREGY-QVVLAKDGVDALQHLQS--VTPDVMLVDIEMPRMDGF 1904 Query: 69 ALLKKIRSTPSLAHLPVLMITAEAKKENIVVAAQAGADGYIVKPFNAVTL 118 L + IR +P++MIT+ ++ A + G + Y+ KP+ L Sbjct: 1905 DLTRNIRDDERTRDIPIIMITSRTASKHRNYAMELGVNEYLGKPYQEEAL 1954 Database: BlastDatabases/690/690 Posted date: Apr 9, 2011 4:48 AM Number of letters in database: 1,000,347 Number of sequences in database: 3295 Lambda K H 0.319 0.133 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3295 Number of Hits to DB: 238,665 Number of extensions: 8840 Number of successful extensions: 86 Number of sequences better than 1.0e-08: 13 Number of HSP's gapped: 101 Number of HSP's successfully gapped: 13 Length of query: 135 Length of database: 1,000,347 Length adjustment: 72 Effective length of query: 63 Effective length of database: 763,107 Effective search space: 48075741 Effective search space used: 48075741 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 124 (52.4 bits)