BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.1447.p (133 letters) Database: BlastDatabases/690/690 3295 sequences; 1,000,347 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|134094532|ref|YP_001099607.1| chemotactic response regulator ... 167 2e-43 gi|134094525|ref|YP_001099600.1| chemotactic response regulator ... 78 2e-16 gi|134094343|ref|YP_001099418.1| response regulator [Herminiimon... 63 5e-12 gi|134095906|ref|YP_001100981.1| putative composite two componen... 61 2e-11 gi|134093754|ref|YP_001098829.1| two-component regulatory system... 58 2e-10 >gi|134094532|ref|YP_001099607.1| chemotactic response regulator [Herminiimonas arsenicoxydans] Length = 132 Score = 167 bits (423), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 84/130 (64%), Positives = 99/130 (76%), Gaps = 2/130 (1%) Query: 1 MADTDQHFLVVDDFSTMRRIVSGLLKELEYTKIVEADDGSTALKILESGASNITFVLTDW 60 MA + FLVVDDFSTMRRIV LLKEL YT + EA+DG AL L S FV++DW Sbjct: 1 MAGPNTKFLVVDDFSTMRRIVRNLLKELGYTNVDEAEDGVMALSKLRS--ETFDFVVSDW 58 Query: 61 NMPVMDGLTLLKKIRATPALAHLPVLMITAEAKKENIVMAAQEGADGYIVKPFNAATLKE 120 NMP MDGLT+L++IRA PAL+ LPVLM+TAEAKKENI+ AAQ GA+GY+VKPF AATL E Sbjct: 59 NMPNMDGLTMLQQIRADPALSKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATLDE 118 Query: 121 KIEKILSRRA 130 K+ KI + A Sbjct: 119 KLAKIFEKLA 128 >gi|134094525|ref|YP_001099600.1| chemotactic response regulator [Herminiimonas arsenicoxydans] Length = 121 Score = 77.8 bits (190), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 3/119 (2%) Query: 9 LVVDDFSTMRRIVSGLLKELEYTKIVEADDGSTALKILESGASNITFVLTDWNMPVMDGL 68 L VDD ++R++V L+ Y ++ EA DG L ++ VLTD NMP MDG Sbjct: 6 LAVDDSGSLRQMVVFSLRAAGY-QVTEAVDGQDGLD--KAQMQVFDLVLTDQNMPRMDGF 62 Query: 69 TLLKKIRATPALAHLPVLMITAEAKKENIVMAAQEGADGYIVKPFNAATLKEKIEKILS 127 +L++ +RA P +P+L++T E+ E GA+G++VKPF+ L E ++K++ Sbjct: 63 SLIRALRALPTYQKVPILVLTTESSDEMKAKGRAAGANGWLVKPFDPQRLTEVVKKVIG 121 >gi|134094343|ref|YP_001099418.1| response regulator [Herminiimonas arsenicoxydans] Length = 229 Score = 63.2 bits (152), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 28/75 (37%), Positives = 44/75 (58%) Query: 55 FVLTDWNMPVMDGLTLLKKIRATPALAHLPVLMITAEAKKENIVMAAQEGADGYIVKPFN 114 +L DW +P GL LL +IRA LP++M+TA++ +E+ + GAD Y+ KPF+ Sbjct: 52 LILLDWMLPDQSGLRLLSRIRADRQFNELPIIMLTAKSMEEDKIAGLDNGADDYVTKPFS 111 Query: 115 AATLKEKIEKILSRR 129 L +I +L R+ Sbjct: 112 PRELTARINALLRRK 126 >gi|134095906|ref|YP_001100981.1| putative composite two component regulatory (sensor histidine kinase and response regulator hybrid) transcription regulator protein [Herminiimonas arsenicoxydans] Length = 1969 Score = 61.2 bits (147), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 40/114 (35%), Positives = 61/114 (53%), Gaps = 4/114 (3%) Query: 6 QHF-LVVDDFSTMRRIVSGLLKELEYTKIVEADDGSTALKILESGASNITFVLTDWNMPV 64 QH +VVDD T+RR+ LL Y ++V A DG AL+ L+S ++ +L D MP Sbjct: 1844 QHIVMVVDDSLTVRRVTQRLLTREGY-QVVLAKDGVDALQHLQSVTPDV--MLVDIEMPR 1900 Query: 65 MDGLTLLKKIRATPALAHLPVLMITAEAKKENIVMAAQEGADGYIVKPFNAATL 118 MDG L + IR +P++MIT+ ++ A + G + Y+ KP+ L Sbjct: 1901 MDGFDLTRNIRDDERTRDIPIIMITSRTASKHRNYAMELGVNEYLGKPYQEEAL 1954 >gi|134093754|ref|YP_001098829.1| two-component regulatory system response regulator [Herminiimonas arsenicoxydans] Length = 229 Score = 58.2 bits (139), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 25/76 (32%), Positives = 44/76 (57%) Query: 55 FVLTDWNMPVMDGLTLLKKIRATPALAHLPVLMITAEAKKENIVMAAQEGADGYIVKPFN 114 +L DW +P GL LL ++R + LP++M+TA++ +E+ V + GAD Y+ KPF+ Sbjct: 52 LILLDWMLPDQSGLQLLSRVRESRQFRGLPIIMLTAKSMEEDKVTGLENGADDYVTKPFS 111 Query: 115 AATLKEKIEKILSRRA 130 L ++ +L + Sbjct: 112 PRELIARVTVLLKHKV 127 Database: BlastDatabases/690/690 Posted date: Apr 9, 2011 4:48 AM Number of letters in database: 1,000,347 Number of sequences in database: 3295 Lambda K H 0.318 0.132 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3295 Number of Hits to DB: 231,491 Number of extensions: 8272 Number of successful extensions: 87 Number of sequences better than 1.0e-08: 13 Number of HSP's gapped: 103 Number of HSP's successfully gapped: 13 Length of query: 133 Length of database: 1,000,347 Length adjustment: 72 Effective length of query: 61 Effective length of database: 763,107 Effective search space: 46549527 Effective search space used: 46549527 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 124 (52.4 bits)