BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.1179.p (264 letters) Database: BlastDatabases/690/690 3295 sequences; 1,000,347 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|134094678|ref|YP_001099753.1| putative two-component response... 86 2e-18 gi|134095909|ref|YP_001100984.1| twitching motility protein. pil... 85 3e-18 gi|134095906|ref|YP_001100981.1| putative composite two componen... 75 3e-15 gi|134093856|ref|YP_001098931.1| two-component system response r... 71 6e-14 gi|134096087|ref|YP_001101162.1| two-component system regulatory... 69 2e-13 >gi|134094678|ref|YP_001099753.1| putative two-component response regulator protein [Herminiimonas arsenicoxydans] Length = 315 Score = 86.3 bits (212), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 46/116 (39%), Positives = 64/116 (55%) Query: 19 ILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVYDGLTS 78 +LVVDDA +L + L G + VA DG R PD+ILMD MP G + Sbjct: 17 VLVVDDAPSSLGVLCETLESSGYIVLVACDGDTALRCLTLTTPDIILMDAVMPGMSGFDA 76 Query: 79 CRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEVRLRLCVHL 134 CR +K++ +T++IPLIF++ + T + G + G VDY+ KP EV RL HL Sbjct: 77 CRHIKSDLATKHIPLIFMTGLSDTSHVLEGFACGGVDYVVKPVCAPEVLARLHTHL 132 >gi|134095909|ref|YP_001100984.1| twitching motility protein. pilH ortholog [Herminiimonas arsenicoxydans] Length = 121 Score = 85.1 bits (209), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 41/113 (36%), Positives = 67/113 (59%) Query: 14 LAGQRILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVY 73 +A Q+IL+VDD+ +R L+D L++ G + A +G++ K + +P LILMDI MP Sbjct: 1 MAIQKILIVDDSPTERYFLTDILVKKGFSVSTAENGEEALLKIKADKPQLILMDIVMPGQ 60 Query: 74 DGLTSCRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEV 126 +G R + + T+++P+I ++ ++I GL GA DYI KP D E+ Sbjct: 61 NGFQITRAITRDPETQDVPIIICTSKGQETDRIWGLRQGARDYIVKPVDPAEL 113 >gi|134095906|ref|YP_001100981.1| putative composite two component regulatory (sensor histidine kinase and response regulator hybrid) transcription regulator protein [Herminiimonas arsenicoxydans] Length = 1969 Score = 75.5 bits (184), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 40/123 (32%), Positives = 71/123 (57%), Gaps = 5/123 (4%) Query: 13 PLAGQR----ILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDI 68 P+ G R ++VVDD+ R + L R G ++ +A+DG D + Q+V PD++L+DI Sbjct: 1837 PVQGLRTQHIVMVVDDSLTVRRVTQRLLTREGYQVVLAKDGVDALQHLQSVTPDVMLVDI 1896 Query: 69 RMPVYDGLTSCRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEVRL 128 MP DG R ++ + TR+IP+I +++ A++ + + G +Y+ KP+ EE + Sbjct: 1897 EMPRMDGFDLTRNIRDDERTRDIPIIMITSRTASKHRNYAMELGVNEYLGKPYQ-EEALV 1955 Query: 129 RLC 131 +L Sbjct: 1956 KLI 1958 >gi|134093856|ref|YP_001098931.1| two-component system response regulator [Herminiimonas arsenicoxydans] Length = 231 Score = 71.2 bits (173), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 9/129 (6%) Query: 18 RILVVDDAEEDRILLSDFLLR----HGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVY 73 RILV++D + + D+L+R G + +AR+G+DG A DLI++D+ +P+ Sbjct: 2 RILVIEDEPK----IGDYLVRGLAESGFTVCLARNGRDGLFMATHEAVDLIVLDMMLPLL 57 Query: 74 DGLTSCRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEVRLRLCVH 133 G L++ + ++IP+I L+A E+++ GL GA DY+ KPF F E+ R+ Sbjct: 58 SGWELLTALRSQADKQHIPVICLTARGEVEDRVKGLELGADDYLIKPFAFVELLARIRTL 117 Query: 134 L-RTPLHSE 141 L R+P+ E Sbjct: 118 LRRSPVRDE 126 >gi|134096087|ref|YP_001101162.1| two-component system regulatory protein [Herminiimonas arsenicoxydans] Length = 229 Score = 69.3 bits (168), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 40/118 (33%), Positives = 65/118 (55%), Gaps = 1/118 (0%) Query: 18 RILVVDDAEEDRILLSDFLLRHGARLYVARDGQDGYRKAQTVRPDLILMDIRMPVYDGLT 77 RIL+++D + L FL G L A +G G+ A D +++DI++P DGLT Sbjct: 2 RILIIEDNADIVANLYAFLEPRGYVLDCAANGYAGFALAAQHEYDAVILDIKLPGIDGLT 61 Query: 78 SCRLLKANSSTRNIPLIFLSAAAATEEKITGLSAGAVDYITKPFDFEEVRLRLCVHLR 135 CR ++ + + P++ L+A ++K+ G +GA DY+ KPF EV +RL +R Sbjct: 62 LCRKMR-DELQNDTPVLMLTARDTLDDKVAGFDSGADDYLVKPFSLLEVEVRLKALIR 118 Database: BlastDatabases/690/690 Posted date: Apr 9, 2011 4:48 AM Number of letters in database: 1,000,347 Number of sequences in database: 3295 Lambda K H 0.323 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3295 Number of Hits to DB: 476,123 Number of extensions: 18512 Number of successful extensions: 119 Number of sequences better than 1.0e-08: 20 Number of HSP's gapped: 116 Number of HSP's successfully gapped: 20 Length of query: 264 Length of database: 1,000,347 Length adjustment: 80 Effective length of query: 184 Effective length of database: 736,747 Effective search space: 135561448 Effective search space used: 135561448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 128 (53.9 bits)