BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.4411.p (125 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300313805|ref|YP_003777897.1| two component response regulato... 154 2e-39 gi|300313791|ref|YP_003777883.1| response regulator protein [Her... 64 5e-12 gi|300310669|ref|YP_003774761.1| two component response regulato... 60 4e-11 >gi|300313805|ref|YP_003777897.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 125 Score = 154 bits (389), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 92/121 (76%), Positives = 97/121 (80%) Query: 4 SHRPIAVIDDDLGVRAALCNLLDSAGYRSCSFDCGEDFLVSPCLEQACCAIVDLGLARMS 63 SH IAVIDDD GVRAALCNLLDSAGYRSC F GE+FL S C+ A CAI+DL LA MS Sbjct: 4 SHGAIAVIDDDHGVRAALCNLLDSAGYRSCRFSSGEEFLASDCMPVAVCAIIDLQLACMS 63 Query: 64 GFELAEQLAQLRPTLPLLLISAQVTPPQRQRALALGFPLLTKPVDADTLLVLLTATLLYG 123 GFELAE+LA RP LPLL ISAQVTP Q+QRA ALG LL KPVDADTLL LLTA LLYG Sbjct: 64 GFELAERLALARPDLPLLFISAQVTPRQQQRASALGGALLAKPVDADTLLALLTACLLYG 123 Query: 124 R 124 R Sbjct: 124 R 124 >gi|300313791|ref|YP_003777883.1| response regulator protein [Herbaspirillum seropedicae SmR1] Length = 206 Score = 63.5 bits (153), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 38/110 (34%), Positives = 58/110 (52%), Gaps = 1/110 (0%) Query: 5 HRPIAVIDDDLGVRAALCNLLDSAGYRSCSFDCGEDFLVSPCLEQACCAIVDLGLARMSG 64 R + V+DDD VR AL LL SAGY + F ++FL + CC ++D+ + G Sbjct: 2 ERTVFVVDDDNMVRTALLRLLASAGYAAHGFASADEFLQARLPAVPCCLLLDMKMPGSDG 61 Query: 65 FELAEQLAQLRPTLPLLLISAQVTPPQRQRALALG-FPLLTKPVDADTLL 113 FE+ +L + +P++ IS T P +A+ G LTKP+ + LL Sbjct: 62 FEVVRRLERRGDAIPVIFISGYGTIPTTVQAMKAGAHEFLTKPIQDERLL 111 >gi|300310669|ref|YP_003774761.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 214 Score = 60.5 bits (145), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 35/116 (30%), Positives = 60/116 (51%), Gaps = 1/116 (0%) Query: 8 IAVIDDDLGVRAALCNLLDSAGYRSCSFDCGEDFLVSPCLEQACCAIVDLGLARMSGFEL 67 + ++DDD VR +L LL S R+ F+ E FL + C I+D+ + +SGF+L Sbjct: 9 VYIVDDDEAVRTSLAWLLSSVNIRTECFEGPEAFLKAYDANSLSCLILDVRMPEISGFQL 68 Query: 68 AEQLAQLRPTLPLLLISAQVTPPQRQRALALG-FPLLTKPVDADTLLVLLTATLLY 122 ++L ++ +P++ +S P RAL G L KP ++ +L + TL + Sbjct: 69 QDRLKEIGADIPVIFVSGHGDIPMSVRALHNGAVDFLEKPYNSQQMLERIQMTLKH 124 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.325 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 308,749 Number of extensions: 9817 Number of successful extensions: 95 Number of sequences better than 1.0e-08: 4 Number of HSP's gapped: 100 Number of HSP's successfully gapped: 4 Length of query: 125 Length of database: 1,619,870 Length adjustment: 75 Effective length of query: 50 Effective length of database: 1,264,745 Effective search space: 63237250 Effective search space used: 63237250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 125 (52.8 bits)