BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.3176.p (138 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300312802|ref|YP_003776894.1| two component response regulato... 137 4e-34 gi|300310245|ref|YP_003774337.1| receiver domain-containing prot... 125 1e-30 gi|300313044|ref|YP_003777136.1| two component response regulato... 96 1e-21 gi|300312677|ref|YP_003776769.1| two component hybrid sensor his... 68 3e-13 gi|300313045|ref|YP_003777137.1| two component sensor histidine ... 65 2e-12 >gi|300312802|ref|YP_003776894.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 125 Score = 137 bits (345), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 71/121 (58%), Positives = 91/121 (75%), Gaps = 3/121 (2%) Query: 8 TGTGRILLVVEDNVEVSSLFSAVLAIEGYTVMEARNGMKALELMERHP--IDVILTDLKM 65 +GT +L VVEDN EV +L+S VL +GY V+EA NG AL ++ P +DVILTDL+M Sbjct: 5 SGTSTVL-VVEDNSEVRALYSEVLRSDGYRVLEAANGTLALSVLFDRPGDVDVILTDLRM 63 Query: 66 PVMDGLEFAQKVKADERFAHIPIVLLSATPMTNSGEALQTFSALLTKPCPLEEVILTVNR 125 P+MDGLE A+ +KADERF+ IP+VLLSATPMTNS A + F+ALLTKPCPL ++ T+ Sbjct: 64 PLMDGLELAETLKADERFSAIPLVLLSATPMTNSWHARKNFAALLTKPCPLNLLLSTIEA 123 Query: 126 V 126 V Sbjct: 124 V 124 >gi|300310245|ref|YP_003774337.1| receiver domain-containing protein [Herbaspirillum seropedicae SmR1] Length = 125 Score = 125 bits (314), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 61/118 (51%), Positives = 83/118 (70%), Gaps = 2/118 (1%) Query: 12 RILLVVEDNVEVSSLFSAVLAIEGYTVMEARNGMKALELMERHP--IDVILTDLKMPVMD 69 R +L++EDN+ V +F+ V GY V +A NG + LE++ P + V+LTDL+MPVMD Sbjct: 8 RAILIIEDNLYVREIFAEVFDAAGYEVHQAGNGAEGLEILLSSPGRVSVVLTDLRMPVMD 67 Query: 70 GLEFAQKVKADERFAHIPIVLLSATPMTNSGEALQTFSALLTKPCPLEEVILTVNRVQ 127 GL FA ++K D RFA +P+VLLSATPM NS EA + F+ALL KPCP +++ TV VQ Sbjct: 68 GLRFATELKKDVRFAGLPVVLLSATPMANSWEARKVFAALLVKPCPFSQLLDTVEAVQ 125 >gi|300313044|ref|YP_003777136.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 122 Score = 95.5 bits (236), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 48/116 (41%), Positives = 77/116 (66%), Gaps = 3/116 (2%) Query: 12 RILLVVEDNVEVSSLFSAVLAIEGYTVMEARNGMKALELMERHPIDVILTDLKMPVMDGL 71 + +LVVED+ + L +LA +G +VM A +G++A+ LM+ ++LTDL+MP MDG+ Sbjct: 7 KTVLVVEDHPDSRDLLCEILAHKGLSVMAASDGVEAIALMQSQAPSLVLTDLRMPRMDGM 66 Query: 72 EFAQKVKADERFAHIPIVLLSAT-PMTNSGEALQTFSALLTKPCPLEEVILTVNRV 126 E A+ +K+DERF HIP+ L+SA P N+ + SA L KPC ++ ++ TV ++ Sbjct: 67 ELARYIKSDERFGHIPVALISANLPAANA--RVPEISAFLLKPCSVDHLLTTVTQL 120 >gi|300312677|ref|YP_003776769.1| two component hybrid sensor histidine kinase/response regulator protein [Herbaspirillum seropedicae SmR1] Length = 1160 Score = 67.8 bits (164), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 45/127 (35%), Positives = 71/127 (55%), Gaps = 9/127 (7%) Query: 11 GRILLVVEDNVEVSSLFSAVLAIEGYTVMEARNGMKALELMERH------PIDVILTDLK 64 GR +LVVED+V S+VL +G V ARNG +AL+ ++R PID++L D+ Sbjct: 1034 GRRILVVEDDVRNIFALSSVLEPKGMKVEIARNGREALQALQRSQDKPDAPIDLVLMDIM 1093 Query: 65 MPVMDGLEFAQKVKADERFAHIPIVLLSATPMTNSGEALQTFSA--LLTKPCPLEEVILT 122 MP MDGL ++++ + +PI+ L+A M + E A + KP +E+ +L+ Sbjct: 1094 MPEMDGLTAMREIRKQAVWKRLPIIALTAKAMKDDQEKCLAAGANDYIAKPLDVEK-LLS 1152 Query: 123 VNRVQQP 129 + RV P Sbjct: 1153 LVRVWMP 1159 >gi|300313045|ref|YP_003777137.1| two component sensor histidine kinase [Herbaspirillum seropedicae SmR1] Length = 120 Score = 65.5 bits (158), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/114 (28%), Positives = 65/114 (57%), Gaps = 1/114 (0%) Query: 13 ILLVVEDNVEVSSLFSAVLAIEGYTVMEARNGMKALELMERHPIDVILTDLKMPVMDGLE 72 +LL+V+D V+++ +S +L + GY V+ A +G AL+ +H D++++D MPVM+GLE Sbjct: 3 LLLIVDDEVDITDTYSMLLELHGYRVITACHGADALDKARQHWPDLVISDCMMPVMNGLE 62 Query: 73 FAQKVKADERFAHIPIVLLSATPMTNSGEALQTFSALLTKPCPLEEVILTVNRV 126 ++ A +P++L S P + + + + L KP + ++ + R+ Sbjct: 63 LCAALRRLPGGAQLPVILCSGAPERHD-LSQSSHNLFLRKPVFFDRLLEEIGRL 115 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.319 0.135 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 387,683 Number of extensions: 13067 Number of successful extensions: 117 Number of sequences better than 1.0e-08: 15 Number of HSP's gapped: 123 Number of HSP's successfully gapped: 15 Length of query: 138 Length of database: 1,619,870 Length adjustment: 76 Effective length of query: 62 Effective length of database: 1,260,010 Effective search space: 78120620 Effective search space used: 78120620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 126 (53.1 bits)