BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0001.1556.p (172 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory D... 328 1e-91 gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory p... 160 4e-41 gi|300312490|ref|YP_003776582.1| transcription regulator protein... 121 4e-29 gi|300310455|ref|YP_003774547.1| AsnC family transcription regul... 105 2e-24 gi|300313266|ref|YP_003777358.1| AsnC family transcription regul... 100 1e-22 >gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory DNA-binding transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 162 Score = 328 bits (841), Expect = 1e-91, Method: Compositional matrix adjust. Identities = 160/162 (98%), Positives = 162/162 (100%) Query: 11 MRTQQQSIRTLDKLDHRILAVLQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVISGY 70 MRTQQQS+RTLDKLDHRILAVLQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVI+GY Sbjct: 1 MRTQQQSVRTLDKLDHRILAVLQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVITGY 60 Query: 71 YARVNPESLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARI 130 YARVNPESLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARI Sbjct: 61 YARVNPESLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARI 120 Query: 131 RGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLDD 172 RGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLDD Sbjct: 121 RGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLDD 162 >gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 160 bits (406), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 73/150 (48%), Positives = 107/150 (71%) Query: 21 LDKLDHRILAVLQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVISGYYARVNPESLG 80 LDK+ +ILA LQ DGRIS +L +V LS C+ERVR+++ G I GY A++NPE L Sbjct: 4 LDKISKKILAELQNDGRISNVDLAARVNLSPAACLERVRKLQEAGYILGYAAQLNPELLD 63 Query: 81 ATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKLL 140 +LLVF+E+ L+ + ++F +F++ V IPE+ ECH+V+G FDYL+K+R++ M YR+ L Sbjct: 64 VSLLVFIEVVLDRTTPDVFAEFKKSVQSIPEIMECHMVAGGFDYLVKSRVKDMNAYREFL 123 Query: 141 GDILLQLPGAAQSKSYVVMEEIKETLALPL 170 G LLQL G ++ +Y VMEE+K T+ LP+ Sbjct: 124 GKSLLQLKGVRETHTYAVMEEVKNTIRLPI 153 >gi|300312490|ref|YP_003776582.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 153 Score = 121 bits (303), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 57/146 (39%), Positives = 90/146 (61%) Query: 20 TLDKLDHRILAVLQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVISGYYARVNPESL 79 +LD++D RIL LQKDGRI EL +++G+S T C +R+ +G + A ++PE L Sbjct: 2 SLDRMDKRILKALQKDGRIGNAELAKKLGMSATACWNHTKRLMEEGYVKEVRAILDPEKL 61 Query: 80 GATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKL 139 G +LV V + L+ + F +F + V I VQEC L++G+FDY IK R++ + + +L Sbjct: 62 GLPVLVTVGVVLDRSTPESFAEFEKAVRDIAAVQECLLLAGEFDYWIKLRVKDLQAFNRL 121 Query: 140 LGDILLQLPGAAQSKSYVVMEEIKET 165 + LL+LPG Q +S+ V+ E+K Sbjct: 122 HANTLLRLPGVRQLRSFFVLNEVKNN 147 >gi|300310455|ref|YP_003774547.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 164 Score = 105 bits (262), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 55/140 (39%), Positives = 85/140 (60%) Query: 21 LDKLDHRILAVLQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVISGYYARVNPESLG 80 LD++D RIL LQ++ RI+ L + VGLS +PC+ RV+R+E+ G ISGY A + E L Sbjct: 9 LDRIDLRILCHLQQNSRITNVILADAVGLSPSPCLIRVKRLEKAGYISGYGAYIRLEKLA 68 Query: 81 ATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKLL 140 +VF E+TL+ F +F + + E+ ECHLVSG +DYL+K R + Y+ ++ Sbjct: 69 DVQIVFTEVTLSDHRREDFAKFESTIRNVDEIIECHLVSGGYDYLLKFMTRSVVHYQSVI 128 Query: 141 GDILLQLPGAAQSKSYVVME 160 +L Q + SY+V++ Sbjct: 129 ESLLEQNLRIEKYFSYIVIK 148 >gi|300313266|ref|YP_003777358.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 159 Score = 99.8 bits (247), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 53/149 (35%), Positives = 83/149 (55%) Query: 21 LDKLDHRILAVLQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVISGYYARVNPESLG 80 LD D RIL +LQ++ IS EL ++ LS +P + RV+R+E +G+IS Y A +P LG Sbjct: 3 LDTTDLRILNILQENSSISNLELASRINLSPSPTLARVKRLESEGIISRYVALADPHLLG 62 Query: 81 ATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKLL 140 + VFV++ L + QF V EV E +L++GD DYL++ + + + Sbjct: 63 LKVNVFVKVILERQGAEALAQFETAVSAFDEVMEVYLMTGDEDYLLRIVVPDLLTLEHFI 122 Query: 141 GDILLQLPGAAQSKSYVVMEEIKETLALP 169 D L ++PG +S +++IK ALP Sbjct: 123 VDHLTKIPGIKNIRSSFALKQIKYKTALP 151 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.323 0.139 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 480,718 Number of extensions: 18327 Number of successful extensions: 77 Number of sequences better than 1.0e-08: 9 Number of HSP's gapped: 77 Number of HSP's successfully gapped: 9 Length of query: 172 Length of database: 1,619,870 Length adjustment: 79 Effective length of query: 93 Effective length of database: 1,245,805 Effective search space: 115859865 Effective search space used: 115859865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 127 (53.5 bits)