BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0036.0070.p (77 letters) Database: COGmodified 192,987 sequences; 59,019,183 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value mll5490 Non COG 94 9e-20 RSc1176 [R] COG4172 ABC-type uncharacterized transport system, d... 92 3e-19 AGc320 [R] COG4172 ABC-type uncharacterized transport system, du... 91 5e-19 PA2061 [R] COG4172 ABC-type uncharacterized transport system, du... 91 6e-19 BMEII0738 [R] COG4172 ABC-type uncharacterized transport system,... 90 2e-18 >mll5490 Non COG Length = 543 Score = 93.6 bits (231), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 42/77 (54%), Positives = 59/77 (76%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 VQ QV+ LL LQ +H LAYLFI+HDL V++A+A+ VIVM++G++VE+GP+ Q+ + PQ Sbjct: 461 VQAQVVDLLRNLQAKHDLAYLFISHDLKVIRALANDVIVMRNGQIVEAGPSQQIFENPQT 520 Query: 61 EYTRRLVVAATYAEAAP 77 +YTR L+ AA E AP Sbjct: 521 DYTRALISAAFKIETAP 537 Score = 81.3 bits (199), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 36/69 (52%), Positives = 49/69 (71%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 VQ Q+L+LLA L+ R G++ LFITHDL +V+ +A +V VM GK+VE+GPT + PQ Sbjct: 192 VQAQILELLAGLKSRKGMSMLFITHDLGIVRKIADRVCVMTKGKIVETGPTKDIFANPQH 251 Query: 61 EYTRRLVVA 69 YTR L+ A Sbjct: 252 PYTRHLLAA 260 >RSc1176 [R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component Rso Ralstonia solanacearum Length = 551 Score = 92.0 bits (227), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 43/77 (55%), Positives = 59/77 (76%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 +QQQVL LL+ LQ+++ L+YLFI+HDLAV++AM+H+V+VMKDGKVVE+G T VL+ P Sbjct: 473 IQQQVLSLLSALQKKYNLSYLFISHDLAVIRAMSHRVMVMKDGKVVEAGDTEAVLESPSH 532 Query: 61 EYTRRLVVAATYAEAAP 77 YT +L+ AA P Sbjct: 533 PYTCKLMAAAALKPLQP 549 Score = 66.6 bits (161), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 34/67 (50%), Positives = 47/67 (70%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 V+ Q+LQLL +LQ +G+A + ITHDL +V+A A +V VM+ G +VE+G TA V PQ Sbjct: 201 VRMQILQLLRDLQAEYGMAVMLITHDLNMVRAFAERVGVMERGVLVETGETATVFSAPQH 260 Query: 61 EYTRRLV 67 YT RL+ Sbjct: 261 PYTVRLL 267 >AGc320 [R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component Atu Agrobacterium tumefaciens strain C58 (Cereon) Length = 549 Score = 91.3 bits (225), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 44/75 (58%), Positives = 58/75 (77%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 VQ QV+ LL +LQ +H LAYLFI+HDL VV+A+A+ +IVM+ GKVVESGP A++ PQQ Sbjct: 467 VQAQVVDLLRDLQAKHELAYLFISHDLRVVKALANDLIVMRHGKVVESGPAAEIFANPQQ 526 Query: 61 EYTRRLVVAATYAEA 75 +YT+ L+ AA EA Sbjct: 527 DYTKALLAAAFNIEA 541 Score = 78.6 bits (192), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 36/74 (48%), Positives = 49/74 (66%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 VQ Q+L+LL +L+ +HG++ LFITHDL +V+ A +V VM GK+VE+G QV PQ Sbjct: 198 VQAQILELLGDLKTQHGMSMLFITHDLGIVRKFADRVCVMTKGKIVETGTVEQVFTDPQH 257 Query: 61 EYTRRLVVAATYAE 74 YTR L+ A E Sbjct: 258 AYTRHLLAAEPKGE 271 >PA2061 [R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component Pae Pseudomonas aeruginosa Length = 536 Score = 90.9 bits (224), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 42/69 (60%), Positives = 55/69 (79%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 VQ QV++LL LQRRHGL+YLFI+HDLAVV+A+AH ++V+KDG+VVE G A + QP+ Sbjct: 451 VQCQVVELLRRLQRRHGLSYLFISHDLAVVRALAHDILVLKDGRVVEQGSAAALFSQPRH 510 Query: 61 EYTRRLVVA 69 YTR L+ A Sbjct: 511 PYTRELLGA 519 Score = 67.4 bits (163), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 33/77 (42%), Positives = 50/77 (64%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 VQ+++L+LL LQRR G+A L I+HDL +V+ +A +V VM+DG++VE + + P+ Sbjct: 185 VQKRLLELLQSLQRRLGMAILLISHDLNLVRRVADRVCVMRDGQIVEENACETLFRSPRH 244 Query: 61 EYTRRLVVAATYAEAAP 77 YTR L+ A A P Sbjct: 245 PYTRLLIEAEPGGLAEP 261 >BMEII0738 [R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component Bme Brucella melitensis Length = 551 Score = 89.7 bits (221), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 41/74 (55%), Positives = 58/74 (78%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 VQ+Q++ LL +LQ+ HGL+YLFI+HD+AVV+A++ VIVMK+GK+VE G T QV P++ Sbjct: 472 VQKQIVTLLRDLQKDHGLSYLFISHDMAVVRAVSDYVIVMKNGKIVEQGDTEQVFDHPRE 531 Query: 61 EYTRRLVVAATYAE 74 EYT+ L+ AA E Sbjct: 532 EYTKALMAAALSEE 545 Score = 78.2 bits (191), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 37/77 (48%), Positives = 53/77 (68%) Query: 1 VQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGPTAQVLQQPQQ 60 +Q Q+L LLA+LQ+R G+A +FITHDL +V+ A +V VM+ G+VVE+G T ++ P+ Sbjct: 205 IQAQILDLLADLQKRLGMAVVFITHDLGIVRRFADRVYVMRSGEVVETGVTEKLFTAPEH 264 Query: 61 EYTRRLVVAATYAEAAP 77 YTR L+ A E AP Sbjct: 265 PYTRMLLDAEPEGEKAP 281