BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0037.0171.p (65 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003775388.1| 50S ribosomal protein L35 [Herbaspirillum se... 130 5e-29 ref|YP_001353179.1| 50S ribosomal subunit protein A [Janthinobac... 119 2e-25 ref|NP_519700.1| 50S ribosomal protein L35 [Ralstonia solanacear... 117 6e-25 ref|ZP_00945324.1| LSU ribosomal protein L35P [Ralstonia solanac... 117 7e-25 ref|YP_001899542.1| 50S ribosomal protein L35 [Ralstonia pickett... 115 3e-24 ref|YP_003752312.1| 50S ribosomal subunit protein A [Ralstonia s... 114 3e-24 ref|YP_004752157.1| 50S ribosomal subunit protein A [Collimonas ... 113 8e-24 ref|YP_001100079.1| 50S ribosomal protein L35 [Herminiimonas ars... 113 9e-24 ref|YP_001790779.1| 50S ribosomal protein L35 [Leptothrix cholod... 111 3e-23 ref|YP_559632.1| 50S ribosomal protein L35 [Burkholderia xenovor... 111 3e-23 >ref|YP_003775388.1| 50S ribosomal protein L35 [Herbaspirillum seropedicae SmR1] gb|ADJ63480.1| 50S ribosomal subunit L35 protein [Herbaspirillum seropedicae SmR1] Length = 65 Score = 130 bits (328), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 65/65 (100%), Positives = 65/65 (100%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA Sbjct: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 Query: 61 MLPFA 65 MLPFA Sbjct: 61 MLPFA 65 >ref|YP_001353179.1| 50S ribosomal subunit protein A [Janthinobacterium sp. Marseille] gb|ABR91645.1| 50S ribosomal subunit protein A [Janthinobacterium sp. Marseille] Length = 76 Score = 119 bits (297), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 58/65 (89%), Positives = 62/65 (95%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+KSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRG GVH+TN+NSVRA Sbjct: 12 MPKMKTKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGAVGVHDTNMNSVRA 71 Query: 61 MLPFA 65 M+P A Sbjct: 72 MMPNA 76 >ref|NP_519700.1| 50S ribosomal protein L35 [Ralstonia solanacearum GMI1000] sp|Q8XZ27.1|RL35_RALSO RecName: Full=50S ribosomal protein L35 emb|CAD15281.1| probable 50s ribosomal protein l35 [Ralstonia solanacearum GMI1000] emb|CBJ37778.1| 50S ribosomal subunit protein A [Ralstonia solanacearum CMR15] Length = 65 Score = 117 bits (293), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 56/65 (86%), Positives = 60/65 (92%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+K SA KRF RPGGT+KRGQAFKRHILTKKTTKNKRQLRGTEGVHETNL SVRA Sbjct: 1 MPKMKTKKSASKRFTARPGGTIKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLKSVRA 60 Query: 61 MLPFA 65 M+P+A Sbjct: 61 MMPYA 65 >ref|ZP_00945324.1| LSU ribosomal protein L35P [Ralstonia solanacearum UW551] ref|YP_002259340.1| 50s ribosomal protein l35 [Ralstonia solanacearum IPO1609] ref|YP_003745482.1| 50S ribosomal subunit protein a [Ralstonia solanacearum CFBP2957] gb|EAP72184.1| LSU ribosomal protein L35P [Ralstonia solanacearum UW551] emb|CAQ36224.1| 50s ribosomal protein l35 [Ralstonia solanacearum MolK2] emb|CAQ61270.1| 50s ribosomal protein l35 [Ralstonia solanacearum IPO1609] emb|CBJ42867.1| 50S ribosomal subunit protein A [Ralstonia solanacearum CFBP2957] gb|AEG68953.1| 50s ribosomal protein l35 [Ralstonia solanacearum Po82] Length = 65 Score = 117 bits (292), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 56/65 (86%), Positives = 60/65 (92%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+K SA KRF RPGGT+KRGQAFKRHILTKKTTKNKRQLRGTEGVHETNL SVRA Sbjct: 1 MPKMKTKKSAAKRFTARPGGTIKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLKSVRA 60 Query: 61 MLPFA 65 M+P+A Sbjct: 61 MMPYA 65 >ref|YP_001899542.1| 50S ribosomal protein L35 [Ralstonia pickettii 12J] ref|YP_002981601.1| 50S ribosomal protein L35 [Ralstonia pickettii 12D] ref|ZP_07677252.1| ribosomal protein L35 [Ralstonia sp. 5_7_47FAA] sp|B2UGJ6.1|RL35_RALPJ RecName: Full=50S ribosomal protein L35 gb|ACD27110.1| ribosomal protein L35 [Ralstonia pickettii 12J] gb|ACS62929.1| ribosomal protein L35 [Ralstonia pickettii 12D] gb|EFP64294.1| ribosomal protein L35 [Ralstonia sp. 5_7_47FAA] Length = 65 Score = 115 bits (287), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 55/65 (84%), Positives = 59/65 (90%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+K SA KRF RPGGT+KRGQAFKRHILTKKTTKNKR LRGTEGVHETNL SVRA Sbjct: 1 MPKMKTKKSASKRFTARPGGTIKRGQAFKRHILTKKTTKNKRHLRGTEGVHETNLKSVRA 60 Query: 61 MLPFA 65 M+P+A Sbjct: 61 MMPYA 65 >ref|YP_003752312.1| 50S ribosomal subunit protein A [Ralstonia solanacearum PSI07] emb|CBJ51027.1| 50S ribosomal subunit protein A [Ralstonia solanacearum PSI07] emb|CCA79802.1| 50S ribosomal subunit protein A [blood disease bacterium R229] emb|CCA86350.1| 50S ribosomal subunit protein A [Ralstonia syzygii R24] Length = 65 Score = 114 bits (286), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 55/65 (84%), Positives = 59/65 (90%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+K SA KRF RPGGT+KRGQAFKRHILTKKTTKNKR LRGTEGVHETNL SVRA Sbjct: 1 MPKMKTKKSAAKRFTARPGGTIKRGQAFKRHILTKKTTKNKRHLRGTEGVHETNLKSVRA 60 Query: 61 MLPFA 65 M+P+A Sbjct: 61 MMPYA 65 >ref|YP_004752157.1| 50S ribosomal subunit protein A [Collimonas fungivorans Ter331] gb|AEK61334.1| 50S ribosomal subunit protein A [Collimonas fungivorans Ter331] Length = 65 Score = 113 bits (283), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 57/65 (87%), Positives = 60/65 (92%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+KSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRG+ GVHETN+ SV Sbjct: 1 MPKMKTKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGSVGVHETNMASVSR 60 Query: 61 MLPFA 65 MLP A Sbjct: 61 MLPTA 65 >ref|YP_001100079.1| 50S ribosomal protein L35 [Herminiimonas arsenicoxydans] sp|A4G617.1|RL35_HERAR RecName: Full=50S ribosomal protein L35 emb|CAL61954.1| 50S ribosomal protein L35 [Herminiimonas arsenicoxydans] Length = 65 Score = 113 bits (283), Expect = 9e-24, Method: Compositional matrix adjust. Identities = 56/65 (86%), Positives = 61/65 (93%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+KS AKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRG+ GVH+TN+ SVRA Sbjct: 1 MPKMKTKSGAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGSVGVHDTNMVSVRA 60 Query: 61 MLPFA 65 M+P A Sbjct: 61 MMPNA 65 >ref|YP_001790779.1| 50S ribosomal protein L35 [Leptothrix cholodnii SP-6] sp|B1XYZ5.1|RL35_LEPCP RecName: Full=50S ribosomal protein L35 gb|ACB34014.1| ribosomal protein L35 [Leptothrix cholodnii SP-6] Length = 67 Score = 111 bits (278), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 55/65 (84%), Positives = 58/65 (89%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+KSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKR LRGT VHETN+ + Sbjct: 1 MPKMKTKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRHLRGTVAVHETNMGHIAQ 60 Query: 61 MLPFA 65 MLPFA Sbjct: 61 MLPFA 65 >ref|YP_559632.1| 50S ribosomal protein L35 [Burkholderia xenovorans LB400] ref|ZP_02887124.1| ribosomal protein L35 [Burkholderia graminis C4D1M] ref|ZP_03265526.1| ribosomal protein L35 [Burkholderia sp. H160] ref|YP_003605570.1| ribosomal protein L35 [Burkholderia sp. CCGE1002] ref|ZP_06845896.1| ribosomal protein L35 [Burkholderia sp. Ch1-1] ref|YP_003907624.1| 50S ribosomal protein L35 [Burkholderia sp. CCGE1003] ref|YP_004228887.1| 50S ribosomal protein L35 [Burkholderia sp. CCGE1001] sp|Q13WF9.1|RL35_BURXL RecName: Full=50S ribosomal protein L35 gb|ABE31580.1| LSU ribosomal protein L35P [Burkholderia xenovorans LB400] gb|EDT07256.1| ribosomal protein L35 [Burkholderia graminis C4D1M] gb|EEA02951.1| ribosomal protein L35 [Burkholderia sp. H160] gb|ADG16059.1| ribosomal protein L35 [Burkholderia sp. CCGE1002] gb|EFG66474.1| ribosomal protein L35 [Burkholderia sp. Ch1-1] gb|ADN58333.1| ribosomal protein L35 [Burkholderia sp. CCGE1003] gb|ADX55827.1| ribosomal protein L35 [Burkholderia sp. CCGE1001] Length = 65 Score = 111 bits (278), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 54/65 (83%), Positives = 59/65 (90%) Query: 1 MPKMKSKSSAKKRFRVRPGGTVKRGQAFKRHILTKKTTKNKRQLRGTEGVHETNLNSVRA 60 MPKMK+K SA KRF VRPGGTVKRGQAFKRHILTKKTTKNKR LRG+ VH+++LNSVRA Sbjct: 1 MPKMKTKKSAAKRFVVRPGGTVKRGQAFKRHILTKKTTKNKRHLRGSTAVHDSDLNSVRA 60 Query: 61 MLPFA 65 MLPFA Sbjct: 61 MLPFA 65