BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0037.0143.p (236 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003775365.1| two component response regulator protein [He... 168 7e-40 ref|ZP_07775255.1| response regulator receiver:transcriptional r... 104 9e-21 ref|YP_200198.1| two-component system regulatory protein [Xantho... 101 9e-20 ref|YP_450476.1| two-component system regulatory protein [Xantho... 99 4e-19 ref|ZP_02242601.1| two-component system regulatory protein [Xant... 99 4e-19 ref|ZP_06484854.1| two-component system regulatory protein [Xant... 99 4e-19 ref|YP_004821696.1| winged helix family two component transcript... 99 5e-19 ref|YP_004118684.1| two component transcriptional regulator, win... 98 1e-18 ref|YP_003332456.1| winged helix family two component transcript... 98 1e-18 ref|YP_003376047.1| LuxR family transcriptional regulator [Xanth... 98 1e-18 >ref|YP_003775365.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] gb|ADJ63457.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 234 Score = 168 bits (425), Expect = 7e-40, Method: Compositional matrix adjust. Identities = 80/81 (98%), Positives = 81/81 (100%) Query: 1 VSKGRILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGL 60 +SKGRILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGL Sbjct: 1 MSKGRILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGL 60 Query: 61 SGNEVLAAIRQHASTAVIMVT 81 SGNEVLAAIRQHASTAVIMVT Sbjct: 61 SGNEVLAAIRQHASTAVIMVT 81 >ref|ZP_07775255.1| response regulator receiver:transcriptional regulatory protein [Pseudomonas fluorescens WH6] gb|EFQ62984.1| response regulator receiver:transcriptional regulatory protein [Pseudomonas fluorescens WH6] Length = 229 Score = 104 bits (260), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 50/81 (61%), Positives = 64/81 (79%) Query: 1 VSKGRILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGL 60 +S RILIVEDD D A+IL+AYL R+GF+ A DG + L+L++ WRPDL+LLDVMLP L Sbjct: 1 MSGKRILIVEDDADSANILEAYLRRDGFEVALAEDGQRGLDLHKSWRPDLILLDVMLPRL 60 Query: 61 SGNEVLAAIRQHASTAVIMVT 81 SG EVL+A+R+ + T VIMVT Sbjct: 61 SGTEVLSAVRRSSDTPVIMVT 81 >ref|YP_200198.1| two-component system regulatory protein [Xanthomonas oryzae pv. oryzae KACC10331] gb|AAW74813.1| two-component system regulatory protein [Xanthomonas oryzae pv. oryzae KACC10331] Length = 777 Score = 101 bits (252), Expect = 9e-20, Method: Composition-based stats. Identities = 48/77 (62%), Positives = 61/77 (79%) Query: 5 RILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGLSGNE 64 ++L+VEDD D A IL+AYL R+GF A DG +A++L+R+W PDLVLLDVMLP LSG E Sbjct: 553 KVLLVEDDADSASILEAYLRRDGFDVAVAGDGERAIQLHRQWAPDLVLLDVMLPKLSGIE 612 Query: 65 VLAAIRQHASTAVIMVT 81 VL+AIR+ + T VIMVT Sbjct: 613 VLSAIRRASDTPVIMVT 629 >ref|YP_450476.1| two-component system regulatory protein [Xanthomonas oryzae pv. oryzae MAFF 311018] dbj|BAE68202.1| two-component system regulatory protein [Xanthomonas oryzae pv. oryzae MAFF 311018] Length = 229 Score = 99.4 bits (246), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 48/77 (62%), Positives = 61/77 (79%) Query: 5 RILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGLSGNE 64 ++L+VEDD D A IL+AYL R+GF A DG +A++L+R+W PDLVLLDVMLP LSG E Sbjct: 5 KVLLVEDDADSASILEAYLRRDGFDVAVAGDGERAIQLHRQWAPDLVLLDVMLPKLSGIE 64 Query: 65 VLAAIRQHASTAVIMVT 81 VL+AIR+ + T VIMVT Sbjct: 65 VLSAIRRASDTPVIMVT 81 >ref|ZP_02242601.1| two-component system regulatory protein [Xanthomonas oryzae pv. oryzicola BLS256] ref|YP_001912630.1| two-component system regulatory protein [Xanthomonas oryzae pv. oryzae PXO99A] gb|ACD58098.1| two-component system regulatory protein [Xanthomonas oryzae pv. oryzae PXO99A] Length = 229 Score = 99.4 bits (246), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 48/77 (62%), Positives = 61/77 (79%) Query: 5 RILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGLSGNE 64 ++L+VEDD D A IL+AYL R+GF A DG +A++L+R+W PDLVLLDVMLP LSG E Sbjct: 5 KVLLVEDDADSASILEAYLRRDGFDVAVAGDGERAIQLHRQWAPDLVLLDVMLPKLSGIE 64 Query: 65 VLAAIRQHASTAVIMVT 81 VL+AIR+ + T VIMVT Sbjct: 65 VLSAIRRASDTPVIMVT 81 >ref|ZP_06484854.1| two-component system regulatory protein [Xanthomonas campestris pv. vasculorum NCPPB702] Length = 229 Score = 99.4 bits (246), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 48/77 (62%), Positives = 60/77 (77%) Query: 5 RILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGLSGNE 64 ++L+VEDD D A IL+AYL R+GF A DG +A++L+R+W PDLVLLDVMLP LSG E Sbjct: 5 KVLLVEDDADSASILEAYLRRDGFDVAVAGDGERAIQLHRQWAPDLVLLDVMLPKLSGIE 64 Query: 65 VLAAIRQHASTAVIMVT 81 VL+AIR+ T VIMVT Sbjct: 65 VLSAIRRAGDTPVIMVT 81 >ref|YP_004821696.1| winged helix family two component transcriptional regulator [Enterobacter asburiae LF7a] gb|AEN67320.1| two component transcriptional regulator, winged helix family [Enterobacter asburiae LF7a] Length = 230 Score = 99.0 bits (245), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 47/81 (58%), Positives = 60/81 (74%) Query: 1 VSKGRILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGL 60 +S RILI+EDD D AD+L AYL RE + A DG LE+ +R +PDL+LLDVMLPG+ Sbjct: 1 MSGKRILIIEDDADAADVLSAYLARESYAVSVAGDGPSGLEMSQRLKPDLILLDVMLPGM 60 Query: 61 SGNEVLAAIRQHASTAVIMVT 81 +G EVLAA+R+ +T VIMVT Sbjct: 61 NGTEVLAAVRRRGNTPVIMVT 81 >ref|YP_004118684.1| two component transcriptional regulator, winged helix family [Pantoea sp. At-9b] gb|ADU72128.1| two component transcriptional regulator, winged helix family [Pantoea sp. At-9b] Length = 230 Score = 97.8 bits (242), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 46/81 (56%), Positives = 59/81 (72%) Query: 1 VSKGRILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGL 60 +S RI I+EDD D AD+L AYL RE + A DG LE+ +R RPDL+LLDVMLPG+ Sbjct: 1 MSGKRIQIIEDDADAADVLGAYLRRENYDVSMAHDGPSGLEMSQRLRPDLILLDVMLPGM 60 Query: 61 SGNEVLAAIRQHASTAVIMVT 81 +G E+LAA+R+ +T VIMVT Sbjct: 61 NGTEILAAVRRKGNTPVIMVT 81 >ref|YP_003332456.1| winged helix family two component transcriptional regulator [Dickeya dadantii Ech586] gb|ACZ75751.1| two component transcriptional regulator, winged helix family [Dickeya dadantii Ech586] Length = 231 Score = 97.8 bits (242), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/81 (58%), Positives = 59/81 (72%) Query: 1 VSKGRILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGL 60 +S RILI+EDD D A +L+AYL R+ FQ A DG LE+ R +PDL+LLDVMLPGL Sbjct: 1 MSLKRILIIEDDTDAASVLEAYLKRDNFQVLLAGDGVGGLEMALRVKPDLILLDVMLPGL 60 Query: 61 SGNEVLAAIRQHASTAVIMVT 81 +G EVLAA+R+ + VIMVT Sbjct: 61 NGTEVLAALRRKSDVPVIMVT 81 >ref|YP_003376047.1| LuxR family transcriptional regulator [Xanthomonas albilineans GPE PC73] emb|CBA16057.1| probable two-component system regulatory protein, luxr family [Xanthomonas albilineans] Length = 229 Score = 97.8 bits (242), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 46/77 (59%), Positives = 59/77 (76%) Query: 5 RILIVEDDLDGADILDAYLNREGFQTRQAADGHQALELYRRWRPDLVLLDVMLPGLSGNE 64 +IL+VEDD D A IL+AYL R+GF+ A DG +A+ L+ +W+PDLVLLD+MLP LSG E Sbjct: 5 KILLVEDDADSASILEAYLRRDGFEVAVAEDGQKAVRLHAQWKPDLVLLDIMLPMLSGTE 64 Query: 65 VLAAIRQHASTAVIMVT 81 VL+ IR+ T VIMVT Sbjct: 65 VLSTIRRSGDTPVIMVT 81