BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0031.0267.p (53 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_02886169.1| Integrase catalytic region [Burkholderia gram... 102 3e-20 ref|ZP_02887324.1| Integrase catalytic region [Burkholderia gram... 97 1e-18 ref|YP_001896224.1| integrase [Burkholderia phytofirmans PsJN] >... 97 1e-18 emb|CAB50739.1| putative transposase [Ralstonia metallidurans CH34] 93 1e-17 ref|YP_584141.1| transposase catalytic site IS1087B [Cupriavidus... 93 2e-17 ref|YP_001109707.1| integrase catalytic subunit [Burkholderia vi... 91 8e-17 ref|ZP_04946106.1| Integrase [Burkholderia dolosa AUO158] >gi|12... 90 1e-16 ref|ZP_03586680.1| transposase [Burkholderia multivorans CGD1] >... 89 2e-16 ref|YP_001114754.1| integrase catalytic subunit [Burkholderia vi... 88 5e-16 ref|YP_003603763.1| Integrase catalytic region [Burkholderia sp.... 88 6e-16 >ref|ZP_02886169.1| Integrase catalytic region [Burkholderia graminis C4D1M] gb|EDT08297.1| Integrase catalytic region [Burkholderia graminis C4D1M] Length = 273 Score = 102 bits (253), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 45/53 (84%), Positives = 52/53 (98%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 MKHDY+AFM+KPDVPTAL HLA+AFEQYNERHPHKA+K+RSPR+FRRAAAS+T Sbjct: 221 MKHDYVAFMDKPDVPTALAHLAAAFEQYNERHPHKALKYRSPREFRRAAASST 273 >ref|ZP_02887324.1| Integrase catalytic region [Burkholderia graminis C4D1M] gb|EDT07112.1| Integrase catalytic region [Burkholderia graminis C4D1M] Length = 278 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 43/53 (81%), Positives = 50/53 (94%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 +KHDYIAFM+KPDVPTAL+HLA AFE YNERHPHKA+K+RSPR+FRR AAS+T Sbjct: 226 IKHDYIAFMHKPDVPTALSHLAGAFEHYNERHPHKALKYRSPREFRRTAASST 278 >ref|YP_001896224.1| integrase [Burkholderia phytofirmans PsJN] gb|ACD17000.1| Integrase catalytic region [Burkholderia phytofirmans PsJN] Length = 273 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 43/53 (81%), Positives = 49/53 (92%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 +KHDYIAFM KPDVPTAL+HLA AFE YNERHPHKA+K+RSPR+FRR AAS+T Sbjct: 221 IKHDYIAFMEKPDVPTALSHLADAFEHYNERHPHKALKYRSPREFRRTAASST 273 >emb|CAB50739.1| putative transposase [Ralstonia metallidurans CH34] Length = 411 Score = 93.2 bits (230), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 41/53 (77%), Positives = 47/53 (88%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 MK DYIAFMNKPDVPTAL+ L AFEQYN+ HPHKA+K+RSPR+FRRAA S+T Sbjct: 359 MKRDYIAFMNKPDVPTALSQLTVAFEQYNDWHPHKALKYRSPREFRRAATSST 411 >ref|YP_584141.1| transposase catalytic site IS1087B [Cupriavidus metallidurans CH34] ref|YP_584702.1| transposase IS1087B [Cupriavidus metallidurans CH34] gb|ABF08872.1| transposase catalytic site IS1087B [Cupriavidus metallidurans CH34] gb|ABF09433.1| transposase IS1087B [Cupriavidus metallidurans CH34] Length = 278 Score = 92.8 bits (229), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 41/53 (77%), Positives = 47/53 (88%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 MK DYIAFMNKPDVPTAL+ L AFEQYN+ HPHKA+K+RSPR+FRRAA S+T Sbjct: 226 MKRDYIAFMNKPDVPTALSQLTVAFEQYNDWHPHKALKYRSPREFRRAATSST 278 >ref|YP_001109707.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] gb|ABO59926.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] Length = 278 Score = 90.5 bits (223), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 39/53 (73%), Positives = 49/53 (92%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 MKH+Y+A+M+KPD PTAL+ LA+AFE YNERHPHKA+K+RSPR+FRR AAS+T Sbjct: 226 MKHNYVAYMDKPDAPTALSRLAAAFEHYNERHPHKALKYRSPREFRRTAASST 278 >ref|ZP_04946106.1| Integrase [Burkholderia dolosa AUO158] gb|EAY69277.1| Integrase [Burkholderia dolosa AUO158] Length = 297 Score = 89.7 bits (221), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 39/53 (73%), Positives = 47/53 (88%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 MKHDY+A+M+KPD PTAL+ LA AFE YNERHPHKA+K+RSPR+FRR A S+T Sbjct: 245 MKHDYVAYMDKPDAPTALSRLAIAFEHYNERHPHKALKYRSPREFRRNAVSST 297 >ref|ZP_03586680.1| transposase [Burkholderia multivorans CGD1] gb|EED98967.1| transposase [Burkholderia multivorans CGD1] Length = 278 Score = 89.0 bits (219), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 38/53 (71%), Positives = 48/53 (90%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 MKH+Y+A+M+KPD PTAL+HLA AFE YNERHPHKA+++RSPR+FRR A S+T Sbjct: 226 MKHNYVAYMDKPDAPTALSHLAIAFEHYNERHPHKALQYRSPREFRRNAVSST 278 >ref|YP_001114754.1| integrase catalytic subunit [Burkholderia vietnamiensis G4] gb|ABO58499.1| Integrase, catalytic region [Burkholderia vietnamiensis G4] Length = 278 Score = 87.8 bits (216), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 38/53 (71%), Positives = 47/53 (88%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASAT 53 MKH+Y+A+M+KPD PTAL+ LA AFE YNERHPHKA+K+RSPR+FRR A S+T Sbjct: 226 MKHNYVAYMDKPDAPTALSRLAIAFEHYNERHPHKALKYRSPREFRRNAVSST 278 >ref|YP_003603763.1| Integrase catalytic region [Burkholderia sp. CCGE1002] ref|YP_003609356.1| integrase [Burkholderia sp. CCGE1002] ref|YP_003608099.1| Integrase catalytic region [Burkholderia sp. CCGE1002] gb|ADG14252.1| Integrase catalytic region [Burkholderia sp. CCGE1002] gb|ADG18588.1| Integrase catalytic region [Burkholderia sp. CCGE1002] gb|ADG19845.1| Integrase catalytic region [Burkholderia sp. CCGE1002] Length = 297 Score = 87.8 bits (216), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 38/52 (73%), Positives = 47/52 (90%) Query: 1 MKHDYIAFMNKPDVPTALTHLASAFEQYNERHPHKAVKHRSPRQFRRAAASA 52 MKH+Y+A+M+KPD PTAL+ LA AFE YNERHPHKA+K+RSPR+FRRAA S+ Sbjct: 245 MKHNYVAYMDKPDAPTALSRLAVAFEHYNERHPHKALKYRSPREFRRAAESS 296