BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0029.0338.p (104 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003775201.1| transmembrane protein [Herbaspirillum serope... 205 2e-51 ref|YP_001100092.1| hypothetical protein HEAR1812 [Herminiimonas... 136 1e-30 ref|YP_004752260.1| hypothetical protein CFU_1605 [Collimonas fu... 131 4e-29 ref|YP_001353166.1| hypothetical protein mma_1476 [Janthinobacte... 128 3e-28 ref|ZP_08274722.1| putative transmembrane protein [Oxalobacterac... 115 2e-24 ref|YP_003604575.1| hypothetical protein BC1002_0970 [Burkholder... 110 8e-23 ref|ZP_02355108.1| hypothetical protein BoklE_06467 [Burkholderi... 109 1e-22 ref|YP_004227603.1| hypothetical protein BC1001_1098 [Burkholder... 109 1e-22 ref|ZP_03267322.1| conserved hypothetical protein [Burkholderia ... 109 1e-22 ref|ZP_02462947.1| hypothetical protein Bpse38_06197 [Burkholder... 109 1e-22 >ref|YP_003775201.1| transmembrane protein [Herbaspirillum seropedicae SmR1] gb|ADJ63293.1| transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 104 Score = 205 bits (522), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 103/104 (99%), Positives = 104/104 (100%) Query: 1 MNISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFIVGIV 60 MNISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYF+VGIV Sbjct: 1 MNISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFVVGIV 60 Query: 61 AHLLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSNA 104 AHLLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSNA Sbjct: 61 AHLLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSNA 104 >ref|YP_001100092.1| hypothetical protein HEAR1812 [Herminiimonas arsenicoxydans] emb|CAL61967.1| Conserved hypothetical protein, putative membrane protein [Herminiimonas arsenicoxydans] Length = 101 Score = 136 bits (342), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 68/103 (66%), Positives = 82/103 (79%), Gaps = 3/103 (2%) Query: 1 MNISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFIVGIV 60 M++SL SW VILLA ANLPF N++L A+IP + VKPVWLRL+EL +LY VG+V Sbjct: 1 MDVSLASWFVILLALFCANLPFFNERLLAVIPFPRP---VKPVWLRLIELFLLYLAVGLV 57 Query: 61 AHLLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSN 103 A LLE +G+VF QGWEFYAITGCLFLVLAYPG+VMRY+RK + Sbjct: 58 AGLLELRIGSVFPQGWEFYAITGCLFLVLAYPGFVMRYMRKHH 100 >ref|YP_004752260.1| hypothetical protein CFU_1605 [Collimonas fungivorans Ter331] gb|AEK61437.1| hypothetical protein CFU_1605 [Collimonas fungivorans Ter331] Length = 104 Score = 131 bits (329), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 71/104 (68%), Positives = 87/104 (83%), Gaps = 1/104 (0%) Query: 1 MNISLFSWVVILLAALAANLPFLNQQLFALIPLKKD-PAWVKPVWLRLVELLVLYFIVGI 59 MN+SL SW VILLA LAANLPF+N++LFAL+PLK A VKPVW+RL+EL LY +VG+ Sbjct: 1 MNVSLSSWFVILLALLAANLPFINERLFALVPLKSGGQAAVKPVWVRLLELFALYALVGL 60 Query: 60 VAHLLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSN 103 A++LEA +GN F QGWEFYA+TGC+FLVLAYPGYV+RYL+K Sbjct: 61 FAYVLEANIGNTFRQGWEFYAVTGCMFLVLAYPGYVLRYLKKHR 104 >ref|YP_001353166.1| hypothetical protein mma_1476 [Janthinobacterium sp. Marseille] gb|ABR88615.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille] Length = 92 Score = 128 bits (321), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 59/94 (62%), Positives = 78/94 (82%), Gaps = 3/94 (3%) Query: 10 VILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFIVGIVAHLLEAGVG 69 +ILLA +ANLPF N++LFA++PL KPVWLRL+EL VLY +VG++A +LE+ +G Sbjct: 1 MILLALFSANLPFFNERLFAVLPLSSTS---KPVWLRLIELFVLYLLVGLIARMLESRIG 57 Query: 70 NVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSN 103 +VF QGWEF+AITGCLF+VLAYPG+VMRY+RK + Sbjct: 58 SVFPQGWEFFAITGCLFIVLAYPGFVMRYMRKRH 91 >ref|ZP_08274722.1| putative transmembrane protein [Oxalobacteraceae bacterium IMCC9480] gb|EGF31796.1| putative transmembrane protein [Oxalobacteraceae bacterium IMCC9480] Length = 107 Score = 115 bits (288), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 58/105 (55%), Positives = 73/105 (69%), Gaps = 1/105 (0%) Query: 1 MNISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWV-KPVWLRLVELLVLYFIVGI 59 M+ISL SW V++LA AAN PFL ++LF +I L A K +W RL+ELLVLYF+VG Sbjct: 1 MDISLASWFVVILAFAAANFPFLTERLFGIIALSPKAAPTDKSMWWRLLELLVLYFVVGF 60 Query: 60 VAHLLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSNA 104 L+E G+VF+Q WEFYAI F+VLAYPG+ RYLRK N+ Sbjct: 61 AGRLIEGRTGDVFTQTWEFYAIAAVAFIVLAYPGFAYRYLRKRNS 105 >ref|YP_003604575.1| hypothetical protein BC1002_0970 [Burkholderia sp. CCGE1002] gb|ADG15064.1| conserved hypothetical protein [Burkholderia sp. CCGE1002] Length = 98 Score = 110 bits (274), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 3/101 (2%) Query: 3 ISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFIVGIVAH 62 +S W ++LLA + ANLPFLNQ+LFA +PLK K WLR+ EL+VLYF+VG + Sbjct: 1 MSAAGWFIVLLALVGANLPFLNQRLFAAVPLKAAK---KSAWLRIAELIVLYFVVGTLGF 57 Query: 63 LLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSN 103 LLEA GN F QGW+FYAIT LF+V A+PG+ +YL K Sbjct: 58 LLEARAGNRFEQGWQFYAITFALFVVFAFPGFTFQYLVKRR 98 >ref|ZP_02355108.1| hypothetical protein BoklE_06467 [Burkholderia oklahomensis EO147] ref|ZP_02362311.1| hypothetical protein BoklC_06312 [Burkholderia oklahomensis C6786] Length = 101 Score = 109 bits (273), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 53/101 (52%), Positives = 70/101 (69%) Query: 3 ISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFIVGIVAH 62 +S W ++LLA ANLPFLNQ+LFA++PLK A K W+R+ EL+VLYF+VG + Sbjct: 1 MSAAGWFIVLLALAGANLPFLNQRLFAVVPLKSGAAAKKSAWIRIGELIVLYFVVGALGF 60 Query: 63 LLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSN 103 LE+ GN F QGW+FYAIT LF+V A+PG+ +YL K Sbjct: 61 WLESRAGNRFEQGWQFYAITFSLFVVFAFPGFTFQYLVKRR 101 >ref|YP_004227603.1| hypothetical protein BC1001_1098 [Burkholderia sp. CCGE1001] gb|ADX54543.1| Uncharacterized conserved protein UCP019883, membrane [Burkholderia sp. CCGE1001] Length = 98 Score = 109 bits (273), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 3/101 (2%) Query: 3 ISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFIVGIVAH 62 +S W ++LLA + ANLPFLNQ+LFA +PLK K WLR+ EL+VLYF+VG + Sbjct: 1 MSAAGWFIVLLALVGANLPFLNQRLFAAVPLKAAK---KSAWLRIAELIVLYFVVGALGF 57 Query: 63 LLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSN 103 LLEA GN F QGW+FYAIT LF+V A+PG+ +YL K Sbjct: 58 LLEARAGNRFEQGWQFYAITFALFVVFAFPGFTFQYLLKRR 98 >ref|ZP_03267322.1| conserved hypothetical protein [Burkholderia sp. H160] gb|EEA01081.1| conserved hypothetical protein [Burkholderia sp. H160] Length = 98 Score = 109 bits (272), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 54/101 (53%), Positives = 70/101 (69%), Gaps = 3/101 (2%) Query: 3 ISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFIVGIVAH 62 +S W ++LLA + ANLPFLNQ+LFA +PLK K W+R+ EL+VLYF+VG + Sbjct: 1 MSAAGWFIVLLALVGANLPFLNQRLFAAVPLKATK---KSAWIRIAELIVLYFVVGALGF 57 Query: 63 LLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSN 103 LLEA GN F QGW+FYAIT LF+V A+PG+ +YL K Sbjct: 58 LLEARAGNRFEQGWQFYAITFALFVVFAFPGFTFQYLVKRR 98 >ref|ZP_02462947.1| hypothetical protein Bpse38_06197 [Burkholderia thailandensis MSMB43] Length = 101 Score = 109 bits (272), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 52/101 (51%), Positives = 70/101 (69%) Query: 3 ISLFSWVVILLAALAANLPFLNQQLFALIPLKKDPAWVKPVWLRLVELLVLYFIVGIVAH 62 +S W ++LLA + ANLPFLNQ+LFA++PLK K WLR+ E++VLYF+VG + Sbjct: 1 MSAAGWFIVLLALVGANLPFLNQRLFAVVPLKSGATAKKSAWLRIGEMIVLYFVVGALGF 60 Query: 63 LLEAGVGNVFSQGWEFYAITGCLFLVLAYPGYVMRYLRKSN 103 LE+ GN F QGW+FYAIT LF+V A+PG+ +YL K Sbjct: 61 WLESRAGNRFEQGWQFYAITFSLFVVFAFPGFTFQYLVKRR 101