BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0029.0230.p (123 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003775124.1| chemotaxis CheY protein [Herbaspirillum sero... 248 2e-64 ref|ZP_08781142.1| response regulator receiver protein [Methylob... 179 1e-43 ref|YP_003444413.1| response regulator receiver protein [Allochr... 167 5e-40 ref|YP_002909548.1| response regulator receiver protein [Burkhol... 166 2e-39 ref|ZP_08274622.1| Chemotaxis regulator - transmits chemorecepto... 164 4e-39 ref|ZP_08822982.1| response regulator receiver protein [Thiorhod... 159 1e-37 ref|ZP_08403367.1| response regulator receiver protein [Rubriviv... 135 2e-30 ref|YP_534449.1| response regulator receiver domain-containing p... 134 4e-30 ref|ZP_05925164.1| chemotaxis regulator CheY [Vibrio sp. RC341] ... 132 1e-29 ref|ZP_05237867.1| chemotaxis protein CheY [Vibrio cholerae MO10... 132 2e-29 >ref|YP_003775124.1| chemotaxis CheY protein [Herbaspirillum seropedicae SmR1] gb|ADJ63216.1| chemotaxis CheY protein [Herbaspirillum seropedicae SmR1] Length = 123 Score = 248 bits (634), Expect = 2e-64, Method: Compositional matrix adjust. Identities = 123/123 (100%), Positives = 123/123 (100%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG Sbjct: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 Query: 61 YGFLRQLRGEPLVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVGE 120 YGFLRQLRGEPLVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVGE Sbjct: 61 YGFLRQLRGEPLVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVGE 120 Query: 121 GGQ 123 GGQ Sbjct: 121 GGQ 123 >ref|ZP_08781142.1| response regulator receiver protein [Methylobacter tundripaludum SV96] gb|EGW23317.1| response regulator receiver protein [Methylobacter tundripaludum SV96] Length = 123 Score = 179 bits (454), Expect = 1e-43, Method: Compositional matrix adjust. Identities = 84/120 (70%), Positives = 102/120 (85%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 MKRIL+VDDAATVR+YHRNILEAA Y V+EAVNGIE +EKAL P+DLY+VDINMPKLDG Sbjct: 1 MKRILVVDDAATVRLYHRNILEAAGYAVDEAVNGIEAMEKALQTPFDLYVVDINMPKLDG 60 Query: 61 YGFLRQLRGEPLVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVGE 120 YGFLR++R + + PAIM+STE+++NDR AYRAGAN YL+KPV P LL ++RLL+ E Sbjct: 61 YGFLREIRSQEIAQPPAIMVSTEAESNDRHRAYRAGANIYLIKPVKPDGLLTYIRLLLAE 120 >ref|YP_003444413.1| response regulator receiver protein [Allochromatium vinosum DSM 180] gb|ADC63381.1| response regulator receiver protein [Allochromatium vinosum DSM 180] Length = 124 Score = 167 bits (423), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 78/119 (65%), Positives = 98/119 (82%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 MKRIL++DDAATVR+YHR ILE+A + V EAVNG+E LE+ + P+DLY+VDINMPKLDG Sbjct: 1 MKRILVIDDAATVRLYHRGILESAGFEVSEAVNGLEALERVVEGPFDLYLVDINMPKLDG 60 Query: 61 YGFLRQLRGEPLVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVG 119 YGFLR+LR + + APAIM+STE++ ND+ LAY GAN YL+KP PAQLL HV+ L+G Sbjct: 61 YGFLRELRAKDIPQAPAIMVSTEAEDNDQRLAYACGANLYLIKPTKPAQLLAHVQTLLG 119 >ref|YP_002909548.1| response regulator receiver protein [Burkholderia glumae BGR1] gb|ACR32313.1| response regulator receiver protein [Burkholderia glumae BGR1] Length = 123 Score = 166 bits (419), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 79/122 (64%), Positives = 98/122 (80%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 MKR+L++DDA+TVR YHR+ILE+A + VEEA+NGIE LEKAL PYDLY+VD+NMPKLDG Sbjct: 1 MKRVLIIDDASTVRFYHRSILESAGHAVEEAINGIEALEKALCAPYDLYLVDVNMPKLDG 60 Query: 61 YGFLRQLRGEPLVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVGE 120 YGFLR+LR +P+V APA+M+STE+ D AY AGAN YLVKP +LL +V LL+GE Sbjct: 61 YGFLRELRNQPIVQAPALMVSTEADPIDEHKAYAAGANFYLVKPAKAEELLAYVGLLLGE 120 Query: 121 GG 122 Sbjct: 121 NA 122 >ref|ZP_08274622.1| Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY [Oxalobacteraceae bacterium IMCC9480] gb|EGF31907.1| Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY [Oxalobacteraceae bacterium IMCC9480] Length = 124 Score = 164 bits (415), Expect = 4e-39, Method: Compositional matrix adjust. Identities = 78/121 (64%), Positives = 100/121 (82%), Gaps = 1/121 (0%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 MKRIL+VDDAATVRMYHR+ILE A Y V+EA+NGIE LEKAL+ YDLY+VD+NMPKLDG Sbjct: 1 MKRILIVDDAATVRMYHRSILEDAGYEVDEAINGIEALEKALNATYDLYLVDVNMPKLDG 60 Query: 61 YGFLRQLRGEPLV-HAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVG 119 Y F+R+LRG ++ APA+MISTE++ +D+ A+ AGAN Y++KP P L+ HVRLL+G Sbjct: 61 YSFVRELRGHAMIPQAPAVMISTEAKTSDQTKAFEAGANLYIIKPTRPDLLVAHVRLLLG 120 Query: 120 E 120 + Sbjct: 121 D 121 >ref|ZP_08822982.1| response regulator receiver protein [Thiorhodococcus drewsii AZ1] gb|EGV31911.1| response regulator receiver protein [Thiorhodococcus drewsii AZ1] Length = 130 Score = 159 bits (403), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 77/120 (64%), Positives = 98/120 (81%), Gaps = 1/120 (0%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 MKRIL++DDAATVR+YHR+ILE+A + V EAVNG+E LE+ P+DLY+VD+NMPKLDG Sbjct: 1 MKRILVIDDAATVRLYHRSILESAGFEVTEAVNGLEALERVAEAPFDLYLVDVNMPKLDG 60 Query: 61 YGFLRQLRGE-PLVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVG 119 YGFLR+LRG+ L APAIM+STE+ AND+ A+ +GAN Y VKPV P +LL HV+ L+G Sbjct: 61 YGFLRELRGKNQLPQAPAIMVSTEAAANDQAQAFLSGANLYQVKPVRPERLLSHVQTLLG 120 >ref|ZP_08403367.1| response regulator receiver protein [Rubrivivax benzoatilyticus JA2] gb|EGJ11700.1| response regulator receiver protein [Rubrivivax benzoatilyticus JA2] Length = 145 Score = 135 bits (341), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 69/118 (58%), Positives = 89/118 (75%), Gaps = 7/118 (5%) Query: 3 RILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQ----PYDLYIVDINMPKL 58 +IL+VDDAATVRMYHR +L A + VEEAVNG+E LEK + Q P+DLY+VDINMPK+ Sbjct: 4 QILVVDDAATVRMYHRKMLGDAGWRVEEAVNGVEALEKVIAQPADAPFDLYVVDINMPKM 63 Query: 59 DGYGFLRQLR--GEPLVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHV 114 DGY F+R+LR G+ + AP +M+STE+QA D A+ AGAN YLVKP P +L++ V Sbjct: 64 DGYSFVRELRRLGQ-VPQAPVLMVSTEAQAQDATAAHDAGANCYLVKPAKPTELVLTV 120 >ref|YP_534449.1| response regulator receiver domain-containing protein [Rhodopseudomonas palustris BisB18] gb|ABD90130.1| response regulator receiver domain protein (CheY-like) [Rhodopseudomonas palustris BisB18] Length = 134 Score = 134 bits (338), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 67/121 (55%), Positives = 87/121 (71%), Gaps = 2/121 (1%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 ++RIL+VDD++ VR+Y+R LE A + VE+A+NG+E +EK L Q +DL IVD+NMP++DG Sbjct: 12 LRRILVVDDSSLVRLYYRAALEKAGFAVEQAINGLEAMEKCLAQRFDLVIVDVNMPRMDG 71 Query: 61 YGFLRQLRGEP--LVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLV 118 FLR LRG + PA+MISTE+ DR A AGAN YLVKPV+ A LL HV LL Sbjct: 72 LSFLRALRGSAAEIASLPALMISTEAGQQDRDDARAAGANFYLVKPVSEADLLSHVALLA 131 Query: 119 G 119 G Sbjct: 132 G 132 >ref|ZP_05925164.1| chemotaxis regulator CheY [Vibrio sp. RC341] gb|EEX66449.1| chemotaxis regulator CheY [Vibrio sp. RC341] Length = 123 Score = 132 bits (333), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 61/120 (50%), Positives = 85/120 (70%), Gaps = 1/120 (0%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 MK++++VDDA+TVRMYH+ +LE + EA NG+E LE+AL P DL+++DINMPK+DG Sbjct: 1 MKKVMVVDDASTVRMYHKALLEEIGIFILEASNGVEALERALEMPVDLFLIDINMPKMDG 60 Query: 61 YGFLRQLRGEP-LVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVG 119 + +R++R P L P +MISTESQ +DR GAN Y+VKPV P +L V L++G Sbjct: 61 FTLVREIRCRPELASIPTVMISTESQESDRQQGIHMGANLYMVKPVNPEELQQTVTLMLG 120 >ref|ZP_05237867.1| chemotaxis protein CheY [Vibrio cholerae MO10] ref|ZP_05419727.1| chemotaxis regulator CheY [Vibrio cholera CIRS 101] ref|ZP_06030053.1| chemotaxis regulator CheY [Vibrio cholerae INDRE 91/1] ref|ZP_06036996.1| chemotaxis regulator CheY [Vibrio cholerae RC27] ref|ZP_06048574.1| chemotaxis regulator CheY [Vibrio cholerae CT 5369-93] gb|EET22636.1| chemotaxis protein CheY [Vibrio cholerae MO10] gb|EET92251.1| chemotaxis regulator CheY [Vibrio cholera CIRS 101] gb|EEY40826.1| chemotaxis regulator CheY [Vibrio cholerae RC27] gb|EEY47778.1| chemotaxis regulator CheY [Vibrio cholerae INDRE 91/1] gb|EEY52288.1| chemotaxis regulator CheY [Vibrio cholerae CT 5369-93] gb|AEA78472.1| Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY [Vibrio cholerae LMA3894-4] gb|EGR02968.1| response regulator [Vibrio cholerae HCUF01] gb|EGS48868.1| response regulator [Vibrio cholerae HC-48A1] gb|EGS49021.1| response regulator [Vibrio cholerae HC-70A1] gb|EGS50041.1| response regulator [Vibrio cholerae HC-40A1] gb|EGS64228.1| response regulator [Vibrio cholerae HFU-02] gb|EGS71322.1| response regulator [Vibrio cholerae HC-38A1] Length = 123 Score = 132 bits (332), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 62/120 (51%), Positives = 85/120 (70%), Gaps = 1/120 (0%) Query: 1 MKRILLVDDAATVRMYHRNILEAAHYLVEEAVNGIEGLEKALHQPYDLYIVDINMPKLDG 60 MK++++VDDA+TVRMYH+ +LE + EA NG+E LE+AL P DL++VDINMPK+DG Sbjct: 1 MKKVMVVDDASTVRMYHKALLEEIGIFILEASNGVEALERALEMPVDLFLVDINMPKMDG 60 Query: 61 YGFLRQLRGEP-LVHAPAIMISTESQANDRVLAYRAGANDYLVKPVTPAQLLMHVRLLVG 119 + +R++R P L P +MISTESQ +DR GAN Y+VKPV P +L V L++G Sbjct: 61 FTLVREIRCRPELAGIPTVMISTESQESDRQQGIHMGANLYMVKPVNPEELQQTVTLMLG 120