BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0027.0018.p (114 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003773981.1| general stress protein [Herbaspirillum serop... 87 1e-15 ref|YP_412183.1| hypothetical protein Nmul_A1488 [Nitrosospira m... 81 6e-14 ref|YP_544781.1| hypothetical protein Mfla_0672 [Methylobacillus... 79 3e-13 ref|YP_004617623.1| hypothetical protein Rta_05280 [Ramlibacter ... 77 9e-13 ref|YP_001659458.1| hypothetical protein MAE_44440 [Microcystis ... 77 1e-12 ref|YP_364487.1| hypothetical protein XCV2756 [Xanthomonas campe... 77 1e-12 emb|CAO88513.1| unnamed protein product [Microcystis aeruginosa ... 77 1e-12 ref|ZP_08186507.1| stress-induced acidophilic repeat motif-conta... 77 1e-12 ref|NP_642473.1| hypothetical protein XAC2156 [Xanthomonas axono... 76 1e-12 ref|NP_642872.1| hypothetical protein XAC2557 [Xanthomonas axono... 76 2e-12 >ref|YP_003773981.1| general stress protein [Herbaspirillum seropedicae SmR1] gb|ADJ62073.1| general stress protein [Herbaspirillum seropedicae SmR1] Length = 69 Score = 86.7 bits (213), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 44/59 (74%), Positives = 46/59 (77%) Query: 1 MANAQNPGNSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGGLNSH 59 MAN SNRGFA+MD KQR+IAS GGKAAH KG AHEFTS EAREAGRKGG NSH Sbjct: 1 MANQNQGSTSNRGFASMDENKQREIASQGGKAAHEKGTAHEFTSEEAREAGRKGGQNSH 59 >ref|YP_412183.1| hypothetical protein Nmul_A1488 [Nitrosospira multiformis ATCC 25196] gb|ABB74791.1| conserved hypothetical protein [Nitrosospira multiformis ATCC 25196] Length = 77 Score = 80.9 bits (198), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 40/51 (78%), Positives = 44/51 (86%) Query: 9 NSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGGLNSH 59 S RGFA+MD+EKQR+IAS GGKAAHAKG AHEF+S EAREAGRKGG SH Sbjct: 11 TSKRGFASMDQEKQREIASKGGKAAHAKGTAHEFSSEEAREAGRKGGEASH 61 >ref|YP_544781.1| hypothetical protein Mfla_0672 [Methylobacillus flagellatus KT] gb|ABE48940.1| conserved hypothetical protein [Methylobacillus flagellatus KT] Length = 80 Score = 78.6 bits (192), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 42/55 (76%), Positives = 44/55 (80%) Query: 10 SNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGGLNSHGRKNA 64 S RGFAAM EKQRQIASMGGKAAHAKG AHEF SA AREAGRKGG +H + A Sbjct: 6 SPRGFAAMSPEKQRQIASMGGKAAHAKGTAHEFDSASAREAGRKGGRAAHAKGTA 60 >ref|YP_004617623.1| hypothetical protein Rta_05280 [Ramlibacter tataouinensis TTB310] gb|AEG91604.1| Conserved hypothetical protein [Ramlibacter tataouinensis TTB310] Length = 100 Score = 77.0 bits (188), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 36/49 (73%), Positives = 44/49 (89%) Query: 8 GNSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGGL 56 G+SNRGFA+MD ++QR+IAS GG+AAH KG AHEF+S EAREAGRKGG+ Sbjct: 37 GSSNRGFASMDPQRQREIASQGGRAAHEKGTAHEFSSEEAREAGRKGGM 85 >ref|YP_001659458.1| hypothetical protein MAE_44440 [Microcystis aeruginosa NIES-843] dbj|BAG04266.1| hypothetical protein MAE_44440 [Microcystis aeruginosa NIES-843] Length = 105 Score = 76.6 bits (187), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 38/49 (77%), Positives = 41/49 (83%) Query: 7 PGNSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGG 55 G S RGFA+MD+ KQR+IAS GGKAAH KG AHEFTS EAREAGRKGG Sbjct: 2 TGKSKRGFASMDQAKQREIASKGGKAAHQKGTAHEFTSEEAREAGRKGG 50 >ref|YP_364487.1| hypothetical protein XCV2756 [Xanthomonas campestris pv. vesicatoria str. 85-10] emb|CAJ24435.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] Length = 142 Score = 76.6 bits (187), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 37/48 (77%), Positives = 41/48 (85%) Query: 8 GNSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGG 55 G SNRGFA+MD +KQR+IAS GGKAAH G AHEFTS EAREAG+KGG Sbjct: 86 GTSNRGFASMDEDKQREIASKGGKAAHESGNAHEFTSEEAREAGKKGG 133 >emb|CAO88513.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 105 Score = 76.6 bits (187), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 38/49 (77%), Positives = 41/49 (83%) Query: 7 PGNSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGG 55 G S RGFA+MD+ KQR+IAS GGKAAH KG AHEFTS EAREAGRKGG Sbjct: 2 TGKSKRGFASMDQAKQREIASKGGKAAHQKGTAHEFTSEEAREAGRKGG 50 >ref|ZP_08186507.1| stress-induced acidophilic repeat motif-containing protein [Xanthomonas perforans 91-118] ref|YP_004852096.1| hypothetical protein XACM_2538 [Xanthomonas axonopodis pv. citrumelo F1] gb|EGD15866.1| stress-induced acidophilic repeat motif-containing protein [Xanthomonas perforans 91-118] gb|AEO42798.1| hypothetical protein XACM_2538 [Xanthomonas axonopodis pv. citrumelo F1] Length = 66 Score = 76.6 bits (187), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 38/53 (71%), Positives = 42/53 (79%) Query: 3 NAQNPGNSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGG 55 N G SNRGFA+MD +KQR+IAS GGKAAH G AHEFTS EAREAG+KGG Sbjct: 5 NDNKGGTSNRGFASMDEDKQREIASKGGKAAHESGNAHEFTSEEAREAGKKGG 57 >ref|NP_642473.1| hypothetical protein XAC2156 [Xanthomonas axonopodis pv. citri str. 306] ref|YP_363828.1| hypothetical protein XCV2097 [Xanthomonas campestris pv. vesicatoria str. 85-10] ref|ZP_08188881.1| stress-induced acidophilic repeat motif-containing protein [Xanthomonas perforans 91-118] ref|YP_004851646.1| hypothetical protein XACM_2076 [Xanthomonas axonopodis pv. citrumelo F1] gb|AAM37009.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] emb|CAJ23774.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] gb|EGD13532.1| stress-induced acidophilic repeat motif-containing protein [Xanthomonas perforans 91-118] gb|AEO42348.1| hypothetical protein XACM_2076 [Xanthomonas axonopodis pv. citrumelo F1] Length = 85 Score = 76.3 bits (186), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 39/55 (70%), Positives = 43/55 (78%) Query: 1 MANAQNPGNSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGG 55 M + QN S RGFAA+D EK+R +AS GGKAAHA G AHEFTS EAREAGRKGG Sbjct: 1 MEDGQNTTRSRRGFAALDPEKRRLLASSGGKAAHASGNAHEFTSDEAREAGRKGG 55 >ref|NP_642872.1| hypothetical protein XAC2557 [Xanthomonas axonopodis pv. citri str. 306] gb|AAM37408.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 87 Score = 76.3 bits (186), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 37/48 (77%), Positives = 41/48 (85%) Query: 8 GNSNRGFAAMDREKQRQIASMGGKAAHAKGAAHEFTSAEAREAGRKGG 55 G SNRGFA+MD +KQR+IAS GGKAAH G AHEFTS EAREAG+KGG Sbjct: 31 GTSNRGFASMDEDKQREIASKGGKAAHESGNAHEFTSQEAREAGKKGG 78