BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0025.0022.p (105 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003773547.1| 30S ribosomal protein S10 [Herbaspirillum se... 209 9e-53 ref|YP_001355102.1| small subunit ribosomal protein S10 [Janthin... 202 2e-50 ref|YP_004751060.1| 30S ribosomal protein S10p (S20e) [Collimona... 201 3e-50 ref|YP_001101397.1| 30S ribosomal protein S10 [Herminiimonas ars... 201 4e-50 ref|ZP_08272687.1| SSU ribosomal protein S10p (S20e) [Oxalobacte... 198 3e-49 ref|ZP_08400756.1| 30S ribosomal protein S10 [Rubrivivax benzoat... 197 5e-49 ref|NP_521141.1| 30S ribosomal protein S10 [Ralstonia solanacear... 197 6e-49 ref|YP_001900852.1| 30S ribosomal protein S10 [Ralstonia pickett... 196 7e-49 ref|YP_544390.1| 30S ribosomal protein S10 [Methylobacillus flag... 196 1e-48 ref|YP_001022632.1| 30S ribosomal protein S10 [Methylibium petro... 195 2e-48 >ref|YP_003773547.1| 30S ribosomal protein S10 [Herbaspirillum seropedicae SmR1] emb|CAM32589.1| 30S ribosomal subunit protein S10 [Herbaspirillum seropedicae] gb|ADJ61639.1| 30S ribosomal subunit S10 protein [Herbaspirillum seropedicae SmR1] Length = 105 Score = 209 bits (533), Expect = 9e-53, Method: Compositional matrix adjust. Identities = 105/105 (100%), Positives = 105/105 (100%) Query: 1 MSVPSQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN 60 MSVPSQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN Sbjct: 1 MSVPSQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN 60 Query: 61 KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 61 KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 >ref|YP_001355102.1| small subunit ribosomal protein S10 [Janthinobacterium sp. Marseille] gb|ABR88719.1| small subunit ribosomal protein S10 [Janthinobacterium sp. Marseille] Length = 110 Score = 202 bits (513), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 101/104 (97%), Positives = 102/104 (98%) Query: 2 SVPSQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNK 61 S P+QKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNK Sbjct: 7 SAPNQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNK 66 Query: 62 TSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 TSRDQFEIRTH RLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 67 TSRDQFEIRTHVRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 110 >ref|YP_004751060.1| 30S ribosomal protein S10p (S20e) [Collimonas fungivorans Ter331] gb|AEK60237.1| SSU ribosomal protein S10p (S20e) [Collimonas fungivorans Ter331] Length = 105 Score = 201 bits (511), Expect = 3e-50, Method: Compositional matrix adjust. Identities = 100/105 (95%), Positives = 102/105 (97%) Query: 1 MSVPSQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN 60 MS +QKIRIRLKAFDY+LIDQSA EIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN Sbjct: 1 MSAANQKIRIRLKAFDYKLIDQSAQEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN 60 Query: 61 KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 61 KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 >ref|YP_001101397.1| 30S ribosomal protein S10 [Herminiimonas arsenicoxydans] emb|CAL63276.1| 30S ribosomal subunit protein S10 [Herminiimonas arsenicoxydans] Length = 110 Score = 201 bits (510), Expect = 4e-50, Method: Compositional matrix adjust. Identities = 100/104 (96%), Positives = 102/104 (98%) Query: 2 SVPSQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNK 61 S P+QKIRIRLKAFDYRLIDQSALEIV+TAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNK Sbjct: 7 SAPNQKIRIRLKAFDYRLIDQSALEIVETAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNK 66 Query: 62 TSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 TSRDQFEIRTH RLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 67 TSRDQFEIRTHVRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 110 >ref|ZP_08272687.1| SSU ribosomal protein S10p (S20e) [Oxalobacteraceae bacterium IMCC9480] gb|EGF33839.1| SSU ribosomal protein S10p (S20e) [Oxalobacteraceae bacterium IMCC9480] Length = 105 Score = 198 bits (503), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 98/105 (93%), Positives = 103/105 (98%) Query: 1 MSVPSQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN 60 MS P+Q+IRIRLKAFDYRLIDQSALEIV+TAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN Sbjct: 1 MSSPNQEIRIRLKAFDYRLIDQSALEIVETAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN 60 Query: 61 KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 KTSRDQFEIRTH RL+DIV+PTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 61 KTSRDQFEIRTHVRLIDIVNPTDKTVDALMKLDLPAGVDVEIKLQ 105 >ref|ZP_08400756.1| 30S ribosomal protein S10 [Rubrivivax benzoatilyticus JA2] gb|EGJ09089.1| 30S ribosomal protein S10 [Rubrivivax benzoatilyticus JA2] Length = 104 Score = 197 bits (501), Expect = 5e-49, Method: Compositional matrix adjust. Identities = 96/100 (96%), Positives = 100/100 (100%) Query: 6 QKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNKTSRD 65 QKIRIRLKAFDY+LIDQSALEIVDTAKRTGA+VKGPVPLPTR+QRFD+LRSPHVNKTSRD Sbjct: 5 QKIRIRLKAFDYKLIDQSALEIVDTAKRTGAIVKGPVPLPTRLQRFDILRSPHVNKTSRD 64 Query: 66 QFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 QFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 65 QFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 104 >ref|NP_521141.1| 30S ribosomal protein S10 [Ralstonia solanacearum GMI1000] ref|ZP_00945175.1| SSU ribosomal protein S10P [Ralstonia solanacearum UW551] ref|YP_003751154.1| 30S ribosomal subunit protein S10 [Ralstonia solanacearum PSI07] ref|YP_003744380.1| 30S ribosomal protein S10 [Ralstonia solanacearum CFBP2957] sp|Q8XV11.1|RS10_RALSO RecName: Full=30S ribosomal protein S10 emb|CAD16729.1| probable 30s ribosomal protein s10 [Ralstonia solanacearum GMI1000] gb|EAP72267.1| SSU ribosomal protein S10P [Ralstonia solanacearum UW551] emb|CBJ36583.1| 30S ribosomal subunit protein S10 [Ralstonia solanacearum CMR15] emb|CBJ41736.1| 30S ribosomal subunit protein S10 [Ralstonia solanacearum CFBP2957] emb|CBJ49845.1| 30S ribosomal subunit protein S10 [Ralstonia solanacearum PSI07] gb|AEG67779.1| 30S ribosomal protein S10 [Ralstonia solanacearum Po82] emb|CCA81286.1| 30S ribosomal subunit protein S10 [blood disease bacterium R229] emb|CCA85385.1| 30S ribosomal subunit protein S10 [Ralstonia syzygii R24] Length = 104 Score = 197 bits (500), Expect = 6e-49, Method: Compositional matrix adjust. Identities = 97/101 (96%), Positives = 100/101 (99%) Query: 5 SQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNKTSR 64 +QKIRIRLKAFDYRLIDQSA EIV+TAKRTGA+VKGPVPLPTRIQRFDVLRSPHVNKTSR Sbjct: 4 NQKIRIRLKAFDYRLIDQSAAEIVETAKRTGAIVKGPVPLPTRIQRFDVLRSPHVNKTSR 63 Query: 65 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 64 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 104 >ref|YP_001900852.1| 30S ribosomal protein S10 [Ralstonia pickettii 12J] ref|YP_002982893.1| 30S ribosomal protein S10 [Ralstonia pickettii 12D] ref|ZP_07677553.1| ribosomal protein S10 [Ralstonia sp. 5_7_47FAA] sp|B2UEM0.1|RS10_RALPJ RecName: Full=30S ribosomal protein S10 gb|ACD28420.1| ribosomal protein S10 [Ralstonia pickettii 12J] gb|ACS64221.1| ribosomal protein S10 [Ralstonia pickettii 12D] gb|EFP63934.1| ribosomal protein S10 [Ralstonia sp. 5_7_47FAA] Length = 103 Score = 196 bits (499), Expect = 7e-49, Method: Compositional matrix adjust. Identities = 97/101 (96%), Positives = 100/101 (99%) Query: 5 SQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNKTSR 64 +QKIRIRLKAFDYRLIDQSA EIV+TAKRTGA+VKGPVPLPTRIQRFDVLRSPHVNKTSR Sbjct: 3 NQKIRIRLKAFDYRLIDQSAAEIVETAKRTGAIVKGPVPLPTRIQRFDVLRSPHVNKTSR 62 Query: 65 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 63 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 103 >ref|YP_544390.1| 30S ribosomal protein S10 [Methylobacillus flagellatus KT] sp|Q1H4N8.1|RS10_METFK RecName: Full=30S ribosomal protein S10 gb|ABE48549.1| SSU ribosomal protein S10P [Methylobacillus flagellatus KT] Length = 102 Score = 196 bits (497), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 96/100 (96%), Positives = 100/100 (100%) Query: 5 SQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNKTSR 64 +QKIRIRLKAFDYRLIDQSALEIV+TAKRTGAVVKGPVPLPTRI+RFD+LRSPHVNKTSR Sbjct: 3 AQKIRIRLKAFDYRLIDQSALEIVETAKRTGAVVKGPVPLPTRIERFDILRSPHVNKTSR 62 Query: 65 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 104 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL Sbjct: 63 DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102 >ref|YP_001022632.1| 30S ribosomal protein S10 [Methylibium petroleiphilum PM1] sp|A2SLF8.1|RS10_METPP RecName: Full=30S ribosomal protein S10 gb|ABM96397.1| SSU ribosomal protein S10P [Methylibium petroleiphilum PM1] Length = 103 Score = 195 bits (496), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 95/100 (95%), Positives = 100/100 (100%) Query: 6 QKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNKTSRD 65 QKIRIRLKAFDY+LIDQSALEIVDTAKRTGA+VKGPVPLPTR+QRFD+LRSPHVNK+SRD Sbjct: 4 QKIRIRLKAFDYKLIDQSALEIVDTAKRTGAIVKGPVPLPTRMQRFDILRSPHVNKSSRD 63 Query: 66 QFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 105 QFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ Sbjct: 64 QFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ 103