BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0022.0041.p (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003777733.1| uroporphyrinogen decarboxylase [Herbaspirill... 103 6e-20 ref|ZP_08275585.1| Uroporphyrinogen III decarboxylase [Oxalobact... 96 8e-18 ref|YP_004755016.1| uroporphyrinogen III decarboxylase [Collimon... 96 1e-17 ref|YP_001101608.1| uroporphyrinogen decarboxylase [Herminiimona... 94 3e-17 ref|YP_001355297.1| uroporphyrinogen decarboxylase [Janthinobact... 93 8e-17 ref|YP_004128506.1| uroporphyrinogen decarboxylase [Alicycliphil... 88 2e-15 ref|YP_002796809.1| DcuP [Laribacter hongkongensis HLHK9] >gi|22... 87 5e-15 ref|YP_551054.1| uroporphyrinogen decarboxylase [Polaromonas sp.... 87 6e-15 ref|YP_522102.1| uroporphyrinogen decarboxylase [Rhodoferax ferr... 86 7e-15 ref|ZP_08466812.1| uroporphyrinogen decarboxylase [Kingella king... 86 9e-15 >ref|YP_003777733.1| uroporphyrinogen decarboxylase [Herbaspirillum seropedicae SmR1] gb|ADJ65825.1| uroporphyrinogen decarboxylase protein [Herbaspirillum seropedicae SmR1] Length = 364 Score = 103 bits (256), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 45/46 (97%), Positives = 45/46 (97%) Query: 1 MSTFAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 MSTFAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRA RARA Sbjct: 6 MSTFAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRATRARA 51 >ref|ZP_08275585.1| Uroporphyrinogen III decarboxylase [Oxalobacteraceae bacterium IMCC9480] gb|EGF30945.1| Uroporphyrinogen III decarboxylase [Oxalobacteraceae bacterium IMCC9480] Length = 359 Score = 95.9 bits (237), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 44/47 (93%), Positives = 45/47 (95%), Gaps = 1/47 (2%) Query: 1 MST-FAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 MST FAPLKNDTFLRALLRQPTDYTP+WLMRQAGRYLPEYRA RARA Sbjct: 1 MSTKFAPLKNDTFLRALLRQPTDYTPVWLMRQAGRYLPEYRATRARA 47 >ref|YP_004755016.1| uroporphyrinogen III decarboxylase [Collimonas fungivorans Ter331] gb|AEK64193.1| Uroporphyrinogen III decarboxylase [Collimonas fungivorans Ter331] Length = 362 Score = 95.5 bits (236), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 41/46 (89%), Positives = 43/46 (93%) Query: 1 MSTFAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 MS FAPLKNDTFLRALLRQPTDYTP+WLMRQAGRYLPEYR R+RA Sbjct: 4 MSQFAPLKNDTFLRALLRQPTDYTPLWLMRQAGRYLPEYRKTRSRA 49 >ref|YP_001101608.1| uroporphyrinogen decarboxylase [Herminiimonas arsenicoxydans] sp|A4GAF0.1|DCUP_HERAR RecName: Full=Uroporphyrinogen decarboxylase; Short=UPD; Short=URO-D emb|CAL63487.1| Uroporphyrinogen decarboxylase (URO-D) (UPD) [Herminiimonas arsenicoxydans] Length = 360 Score = 94.4 bits (233), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 40/43 (93%), Positives = 41/43 (95%) Query: 4 FAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 FAPLKNDTFLRALLRQPTDYTPMW+MRQAGRYLPEYRA R RA Sbjct: 5 FAPLKNDTFLRALLRQPTDYTPMWMMRQAGRYLPEYRATRTRA 47 >ref|YP_001355297.1| uroporphyrinogen decarboxylase [Janthinobacterium sp. Marseille] sp|A6T450.1|DCUP_JANMA RecName: Full=Uroporphyrinogen decarboxylase; Short=UPD; Short=URO-D gb|ABR88675.1| uroporphyrinogen decarboxylase [Janthinobacterium sp. Marseille] Length = 360 Score = 92.8 bits (229), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 39/45 (86%), Positives = 43/45 (95%) Query: 2 STFAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 + FAPL+NDTFLRALLRQPT+YTP+WLMRQAGRYLPEYRA RARA Sbjct: 3 TQFAPLQNDTFLRALLRQPTEYTPLWLMRQAGRYLPEYRATRARA 47 >ref|YP_004128506.1| uroporphyrinogen decarboxylase [Alicycliphilus denitrificans BC] ref|YP_004390088.1| uroporphyrinogen decarboxylase [Alicycliphilus denitrificans K601] gb|ADV01619.1| uroporphyrinogen decarboxylase [Alicycliphilus denitrificans BC] gb|AEB86572.1| uroporphyrinogen decarboxylase [Alicycliphilus denitrificans K601] Length = 372 Score = 88.2 bits (217), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 38/45 (84%), Positives = 42/45 (93%) Query: 2 STFAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 +TFAPL+NDTFLRA LRQ TDYTP+WLMRQAGRYLPEY+A RARA Sbjct: 3 NTFAPLRNDTFLRACLRQATDYTPLWLMRQAGRYLPEYKATRARA 47 >ref|YP_002796809.1| DcuP [Laribacter hongkongensis HLHK9] gb|ACO75800.1| DcuP [Laribacter hongkongensis HLHK9] Length = 355 Score = 86.7 bits (213), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 37/40 (92%), Positives = 39/40 (97%) Query: 7 LKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 LKNDTFLRALLRQPTDYTP+W+MRQAGRYLPEYRA RARA Sbjct: 5 LKNDTFLRALLRQPTDYTPVWMMRQAGRYLPEYRATRARA 44 >ref|YP_551054.1| uroporphyrinogen decarboxylase [Polaromonas sp. JS666] sp|Q123Y6.1|DCUP_POLSJ RecName: Full=Uroporphyrinogen decarboxylase; Short=UPD; Short=URO-D gb|ABE46156.1| uroporphyrinogen decarboxylase [Polaromonas sp. JS666] Length = 369 Score = 86.7 bits (213), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 38/43 (88%), Positives = 40/43 (93%) Query: 4 FAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 FAPL+NDTFLRA LRQ TDYTP+WLMRQAGRYLPEYRA RARA Sbjct: 2 FAPLQNDTFLRACLRQATDYTPVWLMRQAGRYLPEYRATRARA 44 >ref|YP_522102.1| uroporphyrinogen decarboxylase [Rhodoferax ferrireducens T118] sp|Q220I2.1|DCUP_RHOFD RecName: Full=Uroporphyrinogen decarboxylase; Short=UPD; Short=URO-D gb|ABD68571.1| uroporphyrinogen decarboxylase [Rhodoferax ferrireducens T118] Length = 369 Score = 86.3 bits (212), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 37/45 (82%), Positives = 41/45 (91%) Query: 2 STFAPLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 S FAPLKNDTFLRA LRQ TDYTP+W+MRQAGR+LPEYRA RA+A Sbjct: 8 SAFAPLKNDTFLRACLRQATDYTPIWMMRQAGRFLPEYRATRAKA 52 >ref|ZP_08466812.1| uroporphyrinogen decarboxylase [Kingella kingae ATCC 23330] gb|EGK10997.1| uroporphyrinogen decarboxylase [Kingella kingae ATCC 23330] Length = 354 Score = 85.9 bits (211), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 35/41 (85%), Positives = 38/41 (92%) Query: 6 PLKNDTFLRALLRQPTDYTPMWLMRQAGRYLPEYRAARARA 46 PL NDTFLRALLRQP DYTP+W+MRQAGRYLPEYRA RA+A Sbjct: 3 PLHNDTFLRALLRQPVDYTPIWMMRQAGRYLPEYRATRAQA 43