BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0018.0054.p (106 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003776693.1| transmembrane protein [Herbaspirillum serope... 217 5e-55 ref|YP_004753562.1| hypothetical protein CFU_2913 [Collimonas fu... 137 6e-31 ref|YP_108563.1| hypothetical protein BPSL1965 [Burkholderia pse... 135 3e-30 ref|ZP_01769085.1| conserved hypothetical protein [Burkholderia ... 134 5e-30 ref|ZP_02455945.1| membrane protein [Burkholderia pseudomallei 9... 132 1e-29 ref|ZP_02463751.1| hypothetical protein Bpse38_10295 [Burkholder... 132 2e-29 ref|YP_559650.1| hypothetical protein Bxe_A1355 [Burkholderia xe... 132 2e-29 ref|YP_295466.1| putative transmembrane protein [Ralstonia eutro... 132 2e-29 ref|YP_001896390.1| hypothetical protein Bphyt_2772 [Burkholderi... 132 2e-29 ref|ZP_02375015.1| hypothetical protein BthaT_28621 [Burkholderi... 131 3e-29 >ref|YP_003776693.1| transmembrane protein [Herbaspirillum seropedicae SmR1] gb|ADJ64785.1| transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 106 Score = 217 bits (552), Expect = 5e-55, Method: Compositional matrix adjust. Identities = 106/106 (100%), Positives = 106/106 (100%) Query: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL Sbjct: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 Query: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVSF 106 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVSF Sbjct: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVSF 106 >ref|YP_004753562.1| hypothetical protein CFU_2913 [Collimonas fungivorans Ter331] gb|AEK62739.1| putative membrane protein [Collimonas fungivorans Ter331] Length = 113 Score = 137 bits (345), Expect = 6e-31, Method: Compositional matrix adjust. Identities = 69/103 (66%), Positives = 85/103 (82%) Query: 4 TLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVALLCG 63 T+ E+ Y +F+EFYP YL +H++R RQLHF+GSTLALL L+ L+LT +WL VAL+CG Sbjct: 11 TVLEKKYETFAEFYPSYLSQHSNRTCRQLHFVGSTLALLSLVALVLTGALYWLAVALVCG 70 Query: 64 YGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVSF 106 YGFAW GHF+ EKN+PAT + PLYS +GDWVMYWQMLTGQVSF Sbjct: 71 YGFAWIGHFVFEKNRPATFKQPLYSLLGDWVMYWQMLTGQVSF 113 >ref|YP_108563.1| hypothetical protein BPSL1965 [Burkholderia pseudomallei K96243] ref|YP_102670.1| hypothetical protein BMA0943 [Burkholderia mallei ATCC 23344] ref|ZP_00441446.1| membrane protein [Burkholderia mallei GB8 horse 4] ref|YP_333264.1| hypothetical protein BURPS1710b_1863 [Burkholderia pseudomallei 1710b] ref|YP_992807.1| hypothetical protein BMASAVP1_A1476 [Burkholderia mallei SAVP1] ref|YP_001026404.1| hypothetical protein BMA10229_A0405 [Burkholderia mallei NCTC 10229] ref|YP_001058727.1| hypothetical protein BURPS668_1686 [Burkholderia pseudomallei 668] ref|YP_001080323.1| hypothetical protein BMA10247_0757 [Burkholderia mallei NCTC 10247] ref|YP_001065980.1| membrane protein [Burkholderia pseudomallei 1106a] ref|ZP_02268713.1| conserved hypothetical protein [Burkholderia mallei PRL-20] ref|ZP_02403113.1| membrane protein [Burkholderia pseudomallei DM98] ref|ZP_02411653.1| membrane protein [Burkholderia pseudomallei 14] ref|ZP_02447782.1| membrane protein [Burkholderia pseudomallei 91] ref|ZP_02471518.1| membrane protein [Burkholderia pseudomallei B7210] ref|ZP_02481986.1| membrane protein [Burkholderia pseudomallei 7894] ref|ZP_02490191.1| membrane protein [Burkholderia pseudomallei NCTC 13177] ref|ZP_02498317.1| membrane protein [Burkholderia pseudomallei 112] ref|ZP_02506338.1| membrane protein [Burkholderia pseudomallei BCC215] ref|ZP_03454854.1| conserved hypothetical protein [Burkholderia pseudomallei 576] ref|YP_002896442.1| membrane protein [Burkholderia pseudomallei MSHR346] ref|ZP_04816786.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] ref|ZP_04884641.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] ref|ZP_04886623.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] ref|ZP_04895077.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] ref|ZP_04904020.1| conserved hypothetical protein [Burkholderia pseudomallei S13] ref|ZP_04905973.1| conserved hypothetical protein [Burkholderia mallei FMH] ref|ZP_04912277.1| conserved hypothetical protein [Burkholderia mallei JHU] ref|ZP_04949288.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] ref|ZP_04965311.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] ref|ZP_04974947.1| conserved hypothetical protein [Burkholderia mallei 2002721280] emb|CAH35964.1| putative membrane protein [Burkholderia pseudomallei K96243] gb|AAU49433.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344] gb|ABA50282.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b] gb|ABM50477.1| conserved hypothetical protein [Burkholderia mallei SAVP1] gb|ABN02134.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229] gb|ABN84912.1| conserved hypothetical protein [Burkholderia pseudomallei 668] gb|ABN88909.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a] gb|ABO04157.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247] gb|EDK56277.1| conserved hypothetical protein [Burkholderia mallei FMH] gb|EDK60433.1| conserved hypothetical protein [Burkholderia mallei JHU] gb|EDK85822.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gb|EDO85038.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gb|EDO91915.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gb|EDP88995.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] gb|EDS87032.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gb|EDU07607.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gb|EEC33232.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gb|ACQ96431.1| membrane protein [Burkholderia pseudomallei MSHR346] gb|EEP87317.1| membrane protein [Burkholderia mallei GB8 horse 4] gb|EES27411.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] gb|EES43655.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gb|EET06307.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] Length = 106 Score = 135 bits (339), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 60/105 (57%), Positives = 77/105 (73%) Query: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 M+ + H+ASF+EFYP YL EH H V+R+LHF+GS + CL + L T WWWL A+ Sbjct: 1 MAHSAHTEHFASFAEFYPFYLDEHRHLVSRRLHFVGSLGVIGCLAMALATGLWWWLPAAV 60 Query: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVS 105 +CGYGFAW GHF EKN+PAT RHP+YS MGDWVM+ + TG++S Sbjct: 61 VCGYGFAWIGHFFFEKNRPATFRHPIYSLMGDWVMFKDICTGKIS 105 >ref|ZP_01769085.1| conserved hypothetical protein [Burkholderia pseudomallei 305] gb|EBA46507.1| conserved hypothetical protein [Burkholderia pseudomallei 305] Length = 106 Score = 134 bits (337), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 59/98 (60%), Positives = 74/98 (75%) Query: 8 RHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVALLCGYGFA 67 H+ASF+EFYP YL EH H V+R+LHF+GS + CL + L T WWWL A++CGYGFA Sbjct: 8 EHFASFAEFYPFYLDEHRHLVSRRLHFVGSLGVIGCLAMALATGLWWWLPAAVVCGYGFA 67 Query: 68 WAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVS 105 W GHF EKN+PAT RHP+YS MGDWVM+ + TG++S Sbjct: 68 WIGHFFFEKNRPATFRHPIYSLMGDWVMFKDICTGKIS 105 >ref|ZP_02455945.1| membrane protein [Burkholderia pseudomallei 9] ref|ZP_03788515.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] gb|EEH30968.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] Length = 106 Score = 132 bits (333), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 59/105 (56%), Positives = 76/105 (72%) Query: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 M+ + H+ASF+EFYP YL EH H V+R+LHF+GS + CL + L WWWL A+ Sbjct: 1 MAHSAHTEHFASFAEFYPFYLDEHRHLVSRRLHFVGSLGVIGCLAMALAMGLWWWLPAAV 60 Query: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVS 105 +CGYGFAW GHF EKN+PAT RHP+YS MGDWVM+ + TG++S Sbjct: 61 VCGYGFAWIGHFFFEKNRPATFRHPIYSLMGDWVMFKDICTGKIS 105 >ref|ZP_02463751.1| hypothetical protein Bpse38_10295 [Burkholderia thailandensis MSMB43] Length = 106 Score = 132 bits (332), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 58/105 (55%), Positives = 77/105 (73%) Query: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 M+ + H+ASF+EFYP YL EH + V+R+LHF+GS + C+ + L T WWWL A+ Sbjct: 1 MAHSAHTEHFASFAEFYPFYLEEHRNLVSRRLHFVGSLGVIGCIAMALATGLWWWLPAAV 60 Query: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVS 105 +CGYGFAW GHF EKN+PAT RHP+YS MGDWVM+ + TG++S Sbjct: 61 VCGYGFAWTGHFFFEKNRPATFRHPIYSLMGDWVMFKDICTGKIS 105 >ref|YP_559650.1| hypothetical protein Bxe_A1355 [Burkholderia xenovorans LB400] ref|ZP_06840946.1| Protein of unknown function DUF2253, membrane [Burkholderia sp. Ch1-1] gb|ABE31598.1| Putative membrane protein [Burkholderia xenovorans LB400] gb|EFG71236.1| Protein of unknown function DUF2253, membrane [Burkholderia sp. Ch1-1] Length = 106 Score = 132 bits (331), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 59/105 (56%), Positives = 75/105 (71%) Query: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 M+ T H+ASF+EFYP YL EH + V+R+LHF+GS + CL + L T W WL A+ Sbjct: 1 MAQTTHTDHFASFAEFYPYYLSEHRNTVSRRLHFVGSLGVIGCLAMALATGDWLWLPAAV 60 Query: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVS 105 +CGYGFAW GHF EKN+PAT RHPLYS MGDWVM+ + G++S Sbjct: 61 ICGYGFAWVGHFFFEKNRPATFRHPLYSLMGDWVMFKDICVGKIS 105 >ref|YP_295466.1| putative transmembrane protein [Ralstonia eutropha JMP134] gb|AAZ60622.1| putative transmembrane protein [Ralstonia eutropha JMP134] Length = 105 Score = 132 bits (331), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 61/99 (61%), Positives = 74/99 (74%) Query: 8 RHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVALLCGYGFA 67 R + SF+ FYP YL EH R R+LHF GST+ALLCLL+L++T WWL A+L GY FA Sbjct: 7 REFESFAAFYPYYLSEHQDRTCRRLHFAGSTVALLCLLMLVVTGNAWWLLGAVLSGYAFA 66 Query: 68 WAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVSF 106 W GHF+ EKN+PAT RHPLYS MGDWVMY +L G++ F Sbjct: 67 WVGHFVFEKNRPATFRHPLYSLMGDWVMYADILRGRIPF 105 >ref|YP_001896390.1| hypothetical protein Bphyt_2772 [Burkholderia phytofirmans PsJN] gb|ACD17166.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] Length = 106 Score = 132 bits (331), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 59/105 (56%), Positives = 75/105 (71%) Query: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 M+ T H+ASF+EFYP YL EH + V+R+LHF+GS + CL + L T W WL A+ Sbjct: 1 MAQTAHTDHFASFAEFYPYYLSEHRNTVSRRLHFVGSLGVIGCLAMALATGDWLWLPAAV 60 Query: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVS 105 +CGYGFAW GHF EKN+PAT RHPLYS MGDWVM+ + G++S Sbjct: 61 ICGYGFAWVGHFFFEKNRPATFRHPLYSLMGDWVMFKDICVGKIS 105 >ref|ZP_02375015.1| hypothetical protein BthaT_28621 [Burkholderia thailandensis TXDOH] Length = 106 Score = 131 bits (330), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 57/105 (54%), Positives = 77/105 (73%) Query: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 M+ + H+ASF+EFYP YL EH + V+R+LHF+GS + C+ + L T WWWL A+ Sbjct: 1 MAHSAHTEHFASFAEFYPFYLDEHRNLVSRRLHFVGSLGVIGCIAMALATGLWWWLPAAV 60 Query: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVS 105 +CGYGFAW GHF EKN+PAT RHP+YS +GDWVM+ + TG++S Sbjct: 61 VCGYGFAWVGHFFFEKNRPATFRHPIYSLIGDWVMFKDICTGKIS 105