BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0016.0081.p (119 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003775477.1| flagellin protein [Herbaspirillum seropedica... 232 1e-59 ref|YP_934208.1| flagellar protein [Azoarcus sp. BH72] >gi|11967... 84 9e-15 ref|YP_004694184.1| flagellar protein FlaG protein [Nitrosomonas... 83 1e-14 ref|YP_741546.1| flagellar protein FlaG protein [Alkalilimnicola... 82 2e-14 ref|NP_841633.1| hypothetical protein NE1594 [Nitrosomonas europ... 82 3e-14 ref|YP_546093.1| flagellar protein FlaG protein [Methylobacillus... 82 4e-14 ref|YP_004039194.1| flagellar protein flag protein [Methylovorus... 82 4e-14 ref|YP_003050524.1| flagellar protein FlaG protein [Methylovorus... 81 4e-14 ref|YP_002889864.1| flagellar protein FlaG protein [Thauera sp. ... 80 7e-14 ref|ZP_01916417.1| hypothetical protein LMED105_11150 [Limnobact... 77 9e-13 >ref|YP_003775477.1| flagellin protein [Herbaspirillum seropedicae SmR1] emb|CAP19678.1| flagellar protein [Herbaspirillum seropedicae] gb|ADJ63569.1| flagellin protein [Herbaspirillum seropedicae SmR1] Length = 119 Score = 232 bits (592), Expect = 1e-59, Method: Compositional matrix adjust. Identities = 119/119 (100%), Positives = 119/119 (100%) Query: 1 MSIAPLNIASAADSGTAYALPKTAAKPDPVVSTVAPVAAPDARRATDSEVNDAVSKLNDF 60 MSIAPLNIASAADSGTAYALPKTAAKPDPVVSTVAPVAAPDARRATDSEVNDAVSKLNDF Sbjct: 1 MSIAPLNIASAADSGTAYALPKTAAKPDPVVSTVAPVAAPDARRATDSEVNDAVSKLNDF 60 Query: 61 AASNAAALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIAIAKSIDKMQGLLINHKA 119 AASNAAALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIAIAKSIDKMQGLLINHKA Sbjct: 61 AASNAAALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIAIAKSIDKMQGLLINHKA 119 >ref|YP_934208.1| flagellar protein [Azoarcus sp. BH72] emb|CAL95321.1| probable flagellar protein [Azoarcus sp. BH72] Length = 134 Score = 83.6 bits (205), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 43/74 (58%), Positives = 53/74 (71%) Query: 46 TDSEVNDAVSKLNDFAASNAAALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIAIAK 105 T +V A+ ++ A L FS DEDTGKTIVKV+D +TD VIRQIPSEE I+IAK Sbjct: 61 TMEQVQQAMDEVRKAITPVAQDLLFSIDEDTGKTIVKVVDASTDEVIRQIPSEEIISIAK 120 Query: 106 SIDKMQGLLINHKA 119 +IDK+QGLL+ KA Sbjct: 121 AIDKLQGLLVQQKA 134 >ref|YP_004694184.1| flagellar protein FlaG protein [Nitrosomonas sp. Is79A3] gb|AEJ00785.1| flagellar protein FlaG protein [Nitrosomonas sp. Is79A3] Length = 123 Score = 83.2 bits (204), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 39/74 (52%), Positives = 54/74 (72%) Query: 46 TDSEVNDAVSKLNDFAASNAAALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIAIAK 105 ++ ++ AV K+ + A L FS DEDTGKTI+KVMD T+ VIRQIP+EEA+ +A+ Sbjct: 50 SEEQIKQAVQKIQGAVDNLAHNLRFSIDEDTGKTIIKVMDVHTEEVIRQIPTEEAVQLAR 109 Query: 106 SIDKMQGLLINHKA 119 ++DK+QGLL N KA Sbjct: 110 TLDKVQGLLFNDKA 123 >ref|YP_741546.1| flagellar protein FlaG protein [Alkalilimnicola ehrlichii MLHE-1] gb|ABI56056.1| flagellar protein FlaG protein [Alkalilimnicola ehrlichii MLHE-1] Length = 143 Score = 82.4 bits (202), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/87 (43%), Positives = 58/87 (66%), Gaps = 3/87 (3%) Query: 36 PVAAPDARRATD---SEVNDAVSKLNDFAASNAAALNFSKDEDTGKTIVKVMDTATDTVI 92 P A D RR TD EV +AV ++N+F L FS DEDTG+T+VKV D+ ++ ++ Sbjct: 57 PARAEDPRRGTDPTAEEVGEAVDRINEFVQLVQRDLEFSIDEDTGRTVVKVFDSQSEELV 116 Query: 93 RQIPSEEAIAIAKSIDKMQGLLINHKA 119 RQ P EE +AIA+ +++++GLL+ +A Sbjct: 117 RQFPPEEILAIAEHLEELKGLLVREQA 143 >ref|NP_841633.1| hypothetical protein NE1594 [Nitrosomonas europaea ATCC 19718] emb|CAD85505.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718] Length = 118 Score = 81.6 bits (200), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 42/88 (47%), Positives = 58/88 (65%), Gaps = 2/88 (2%) Query: 34 VAPVAAPDARRA--TDSEVNDAVSKLNDFAASNAAALNFSKDEDTGKTIVKVMDTATDTV 91 +AP A P A + +V +AV+++ F + L FS DEDTGKT+VK++D T V Sbjct: 31 MAPAAQPPAETSDIKPEQVKEAVNQIQQFTQALTQNLKFSIDEDTGKTVVKIVDAQTQEV 90 Query: 92 IRQIPSEEAIAIAKSIDKMQGLLINHKA 119 IRQ+PSEEAI IA ++ K+QGLL N +A Sbjct: 91 IRQMPSEEAIKIASALGKIQGLLFNGQA 118 >ref|YP_546093.1| flagellar protein FlaG protein [Methylobacillus flagellatus KT] gb|ABE50252.1| flagellar protein FlaG protein [Methylobacillus flagellatus KT] Length = 117 Score = 81.6 bits (200), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 41/113 (36%), Positives = 71/113 (62%) Query: 7 NIASAADSGTAYALPKTAAKPDPVVSTVAPVAAPDARRATDSEVNDAVSKLNDFAASNAA 66 NI + + +G+ + + A P+ + A A A+D++V AV ++N+F + Sbjct: 5 NIEAYSQAGSLASTVRNAGPAVPLPGAGSKEAEQQASVASDADVQSAVEQINEFISPIMQ 64 Query: 67 ALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIAIAKSIDKMQGLLINHKA 119 ++ FS D D+G+ +VKV+D+ T V+RQIP+EE +AI+K++DK+QGL+I A Sbjct: 65 SIQFSTDADSGRVVVKVVDSETQKVLRQIPNEEVLAISKTLDKLQGLIIRQTA 117 >ref|YP_004039194.1| flagellar protein flag protein [Methylovorus sp. MP688] gb|ADQ83958.1| flagellar protein FlaG protein [Methylovorus sp. MP688] Length = 120 Score = 81.6 bits (200), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/77 (48%), Positives = 57/77 (74%) Query: 43 RRATDSEVNDAVSKLNDFAASNAAALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIA 102 + A+D ++ AV LN F + A ++ FS D+D+GK +VKV+DT T+ V+RQIP+EE +A Sbjct: 44 KSASDKDIAAAVKTLNSFISPVAQSVQFSMDQDSGKVVVKVVDTETNKVLRQIPNEEVLA 103 Query: 103 IAKSIDKMQGLLINHKA 119 I+K++DK+QGL+I A Sbjct: 104 ISKTLDKLQGLVIKQTA 120 >ref|YP_003050524.1| flagellar protein FlaG protein [Methylovorus glucosetrophus SIP3-4] gb|ACT49997.1| flagellar protein FlaG protein [Methylovorus glucosetrophus SIP3-4] Length = 120 Score = 81.3 bits (199), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 37/77 (48%), Positives = 57/77 (74%) Query: 43 RRATDSEVNDAVSKLNDFAASNAAALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIA 102 + A+D ++ AV LN F + A ++ FS D+D+GK +VKV+DT T+ V+RQIP+EE +A Sbjct: 44 KTASDKDIAAAVKTLNSFISPVAQSVQFSMDQDSGKVVVKVVDTETNKVLRQIPNEEVLA 103 Query: 103 IAKSIDKMQGLLINHKA 119 I+K++DK+QGL+I A Sbjct: 104 ISKTLDKLQGLVIKQTA 120 >ref|YP_002889864.1| flagellar protein FlaG protein [Thauera sp. MZ1T] gb|ACR01487.1| flagellar protein FlaG protein [Thauera sp. MZ1T] Length = 136 Score = 80.5 bits (197), Expect = 7e-14, Method: Compositional matrix adjust. Identities = 37/72 (51%), Positives = 54/72 (75%) Query: 48 SEVNDAVSKLNDFAASNAAALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIAIAKSI 107 EV A+ ++ A A +L FS D+D+G+T+VKVMDT T+ VIRQIPSEE +AI+K++ Sbjct: 65 GEVQKALEEVEKAVAPMAQSLQFSLDKDSGRTVVKVMDTDTNEVIRQIPSEEVLAISKAV 124 Query: 108 DKMQGLLINHKA 119 DK++GLL+ +A Sbjct: 125 DKLKGLLLKQQA 136 >ref|ZP_01916417.1| hypothetical protein LMED105_11150 [Limnobacter sp. MED105] gb|EDM82394.1| hypothetical protein LMED105_11150 [Limnobacter sp. MED105] Length = 114 Score = 77.0 bits (188), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 45/114 (39%), Positives = 66/114 (57%) Query: 6 LNIASAADSGTAYALPKTAAKPDPVVSTVAPVAAPDARRATDSEVNDAVSKLNDFAASNA 65 +NI++ AD TA P+ A+ P VA + + SEV + V K N SN Sbjct: 1 MNISNMADYATALQKPQDASNTKPAPGVVAKPLLGEKAELSVSEVLEVVQKANAALTSNQ 60 Query: 66 AALNFSKDEDTGKTIVKVMDTATDTVIRQIPSEEAIAIAKSIDKMQGLLINHKA 119 + L F D D GK IV+++D T V++QIPS E + IAK+I+KMQG+L++ +A Sbjct: 61 SNLKFLVDTDNGKPIVQIVDRETQEVLKQIPSVEMLKIAKAIEKMQGVLMSREA 114