BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0011.0061.p (71 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003773969.1| hypothetical protein Hsero_0542 [Herbaspiril... 142 1e-32 ref|YP_298416.1| hypothetical protein Reut_B4219 [Ralstonia eutr... 97 5e-19 ref|YP_002008004.1| hypothetical protein RALTA_B1348 [Cupriavidu... 97 1e-18 ref|YP_841064.1| hypothetical protein H16_B1547 [Ralstonia eutro... 97 1e-18 ref|YP_004681739.1| hypothetical protein CNE_2c15480 [Cupriavidu... 97 1e-18 ref|ZP_06844544.1| conserved hypothetical protein [Burkholderia ... 95 4e-18 ref|YP_001890872.1| hypothetical protein Bphyt_7216 [Burkholderi... 94 7e-18 ref|YP_554868.1| hypothetical protein Bxe_B0429 [Burkholderia xe... 94 8e-18 ref|YP_003910100.1| hypothetical protein BC1003_4886 [Burkholder... 94 8e-18 ref|YP_004231060.1| hypothetical protein BC1001_4611 [Burkholder... 94 8e-18 >ref|YP_003773969.1| hypothetical protein Hsero_0542 [Herbaspirillum seropedicae SmR1] gb|ADJ62061.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1] Length = 71 Score = 142 bits (358), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MNLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSAR 60 MNLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSAR Sbjct: 1 MNLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSAR 60 Query: 61 AGVAAPLAEAA 71 AGVAAPLAEAA Sbjct: 61 AGVAAPLAEAA 71 >ref|YP_298416.1| hypothetical protein Reut_B4219 [Ralstonia eutropha JMP134] gb|AAZ63572.1| hypothetical protein Reut_B4219 [Ralstonia eutropha JMP134] Length = 81 Score = 97.4 bits (241), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 47/62 (75%), Positives = 52/62 (83%) Query: 3 LNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSARAG 62 LNT PNL+RPDDFYEALI+MHR LDD SQA NA+LILLL NHIG HDVLL AM +AR G Sbjct: 13 LNTEPNLARPDDFYEALIDMHRDLDDAQSQAANAQLILLLANHIGDHDVLLAAMHAAREG 72 Query: 63 VA 64 +A Sbjct: 73 IA 74 >ref|YP_002008004.1| hypothetical protein RALTA_B1348 [Cupriavidus taiwanensis LMG 19424] emb|CAQ71948.1| conserved hypothetical protein [Cupriavidus taiwanensis LMG 19424] Length = 74 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/63 (74%), Positives = 51/63 (80%) Query: 3 LNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSARAG 62 LNT PNL+RPDDFYEALI+MHR LD+ SQA NA+LILLL NHIG HDVLL AM RAG Sbjct: 5 LNTQPNLARPDDFYEALIDMHRDLDETQSQAANAQLILLLANHIGDHDVLLAAMSETRAG 64 Query: 63 VAA 65 V A Sbjct: 65 VVA 67 >ref|YP_841064.1| hypothetical protein H16_B1547 [Ralstonia eutropha H16] emb|CAJ96334.1| conserved hypothetical protein [Ralstonia eutropha H16] Length = 74 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/62 (75%), Positives = 51/62 (82%) Query: 2 NLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSARA 61 LNT PNL+RPDDFYEALIEMHR LD+ SQA NA+LILLL NHIG HDVLL AM +AR Sbjct: 4 TLNTQPNLARPDDFYEALIEMHRDLDEAKSQAANAQLILLLANHIGDHDVLLAAMAAARE 63 Query: 62 GV 63 GV Sbjct: 64 GV 65 >ref|YP_004681739.1| hypothetical protein CNE_2c15480 [Cupriavidus necator N-1] gb|AEI80507.1| hypothetical protein CNE_2c15480 [Cupriavidus necator N-1] Length = 74 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/62 (75%), Positives = 51/62 (82%) Query: 2 NLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSARA 61 LNT PNL+RPDDFYEALIEMHR LD+ SQA NA+LILLL NHIG HDVLL AM +AR Sbjct: 4 TLNTQPNLARPDDFYEALIEMHRDLDEAQSQAANAQLILLLANHIGDHDVLLAAMAAARE 63 Query: 62 GV 63 GV Sbjct: 64 GV 65 >ref|ZP_06844544.1| conserved hypothetical protein [Burkholderia sp. Ch1-1] gb|EFG67870.1| conserved hypothetical protein [Burkholderia sp. Ch1-1] Length = 79 Score = 94.7 bits (234), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 45/62 (72%), Positives = 50/62 (80%) Query: 1 MNLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSAR 60 M LNT PNL+RPDDFYEALI+MHR LDD SQ+ NA+LILLL NHIG H LL+AMR AR Sbjct: 1 MTLNTQPNLARPDDFYEALIDMHRDLDDAQSQSANAQLILLLANHIGDHATLLEAMRYAR 60 Query: 61 AG 62 G Sbjct: 61 EG 62 >ref|YP_001890872.1| hypothetical protein Bphyt_7216 [Burkholderia phytofirmans PsJN] gb|ACD21501.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] Length = 78 Score = 94.0 bits (232), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 45/63 (71%), Positives = 51/63 (80%) Query: 1 MNLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSAR 60 M LNT PNL+RPDDFYEALI+MHR LDD SQ+ NA+LILLL NHIG H LL+A+R AR Sbjct: 1 MTLNTQPNLARPDDFYEALIDMHRDLDDAQSQSANAQLILLLANHIGDHATLLEAIRYAR 60 Query: 61 AGV 63 GV Sbjct: 61 EGV 63 >ref|YP_554868.1| hypothetical protein Bxe_B0429 [Burkholderia xenovorans LB400] gb|ABE35518.1| conserved hypothetical protein [Burkholderia xenovorans LB400] Length = 79 Score = 94.0 bits (232), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 44/62 (70%), Positives = 50/62 (80%) Query: 1 MNLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSAR 60 M LNT PNL+RPDDFYEALI+MHR LDD SQ+ NA+LILLL NHIG H L++AMR AR Sbjct: 1 MTLNTQPNLARPDDFYEALIDMHRDLDDAQSQSANAQLILLLANHIGDHATLMEAMRYAR 60 Query: 61 AG 62 G Sbjct: 61 EG 62 >ref|YP_003910100.1| hypothetical protein BC1003_4886 [Burkholderia sp. CCGE1003] gb|ADN60809.1| hypothetical protein BC1003_4886 [Burkholderia sp. CCGE1003] Length = 78 Score = 94.0 bits (232), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 46/64 (71%), Positives = 52/64 (81%) Query: 1 MNLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSAR 60 M LNT PNL+RPDDFYEALI+MHR LDD SQ+ NA+LILLL NHIG H LL+A+R AR Sbjct: 1 MALNTQPNLARPDDFYEALIDMHRDLDDARSQSANAQLILLLANHIGDHATLLEAIRHAR 60 Query: 61 AGVA 64 GVA Sbjct: 61 EGVA 64 >ref|YP_004231060.1| hypothetical protein BC1001_4611 [Burkholderia sp. CCGE1001] gb|ADX58000.1| Protein of unknown function DUF2783 [Burkholderia sp. CCGE1001] Length = 78 Score = 93.6 bits (231), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 46/64 (71%), Positives = 52/64 (81%) Query: 1 MNLNTAPNLSRPDDFYEALIEMHRGLDDEASQAVNARLILLLCNHIGGHDVLLDAMRSAR 60 M LNT PNL+RPDDFYEALI+MHR LDD SQ+ NA+LILLL NHIG H LL+A+R AR Sbjct: 1 MALNTQPNLARPDDFYEALIDMHRDLDDARSQSANAQLILLLANHIGDHATLLEAIRYAR 60 Query: 61 AGVA 64 GVA Sbjct: 61 EGVA 64