BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0007.0175.p (52 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_08138059.1| glyoxalase/bleomycin resistance protein/dioxy... 90 1e-16 ref|YP_972285.1| glyoxalase/bleomycin resistance protein/dioxyge... 90 1e-16 ref|YP_932730.1| lactoylglutathione lyase [Azoarcus sp. BH72] >g... 77 8e-13 ref|YP_001020130.1| lactoylglutathione lyase [Methylibium petrol... 76 2e-12 ref|YP_004535837.1| lactoylglutathione lyase [Novosphingobium sp... 75 4e-12 ref|YP_001523877.1| lactoylglutathione lyase [Azorhizobium cauli... 73 2e-11 ref|YP_004362247.1| glyoxalase/bleomycin resistance protein/diox... 72 4e-11 ref|YP_001170127.1| hypothetical protein Rsph17025_3968 [Rhodoba... 71 4e-11 ref|YP_002982065.1| glyoxalase/bleomycin resistance protein/diox... 71 5e-11 ref|YP_001900092.1| Glyoxalase/bleomycin resistance protein/diox... 71 7e-11 >ref|ZP_08138059.1| glyoxalase/bleomycin resistance protein/dioxygenase [Pseudomonas sp. TJI-51] gb|EGC00655.1| glyoxalase/bleomycin resistance protein/dioxygenase [Pseudomonas sp. TJI-51] Length = 130 Score = 90.1 bits (222), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 39/51 (76%), Positives = 47/51 (92%) Query: 1 LENEHARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHY 51 L+ HARL+ +G++P P+KEFKRG+EMLARFFFIQDPDGYKIEVL+RAGHY Sbjct: 79 LDLHHARLSEIGLSPAPIKEFKRGEEMLARFFFIQDPDGYKIEVLQRAGHY 129 >ref|YP_972285.1| glyoxalase/bleomycin resistance protein/dioxygenase [Acidovorax citrulli AAC00-1] gb|ABM34511.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Acidovorax citrulli AAC00-1] Length = 149 Score = 90.1 bits (222), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 39/52 (75%), Positives = 47/52 (90%) Query: 1 LENEHARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHYI 52 LE EH R+T G++PTP+KEFKRG ++LARFFFIQDPDGYKIEVLER+GHY+ Sbjct: 98 LEAEHERMTGAGMHPTPVKEFKRGQDILARFFFIQDPDGYKIEVLERSGHYV 149 >ref|YP_932730.1| lactoylglutathione lyase [Azoarcus sp. BH72] emb|CAL93843.1| lactoylglutathione lyase [Azoarcus sp. BH72] Length = 133 Score = 77.0 bits (188), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 34/51 (66%), Positives = 40/51 (78%) Query: 1 LENEHARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHY 51 +E EH RL LG+ PT +K F GD ++ARFFFIQDPDGYK+EVLER GHY Sbjct: 82 VEAEHRRLAGLGLGPTDVKRFADGDALIARFFFIQDPDGYKVEVLERHGHY 132 >ref|YP_001020130.1| lactoylglutathione lyase [Methylibium petroleiphilum PM1] gb|ABM93895.1| lactoylglutathione lyase [Methylibium petroleiphilum PM1] Length = 124 Score = 75.9 bits (185), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/46 (71%), Positives = 41/46 (89%) Query: 6 ARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHY 51 A++ +LG PT +KEFKRG+E+LARFFF+QDPDGYKIEVLE+ GHY Sbjct: 78 AQVDALGYAPTAVKEFKRGEELLARFFFVQDPDGYKIEVLEQHGHY 123 >ref|YP_004535837.1| lactoylglutathione lyase [Novosphingobium sp. PP1Y] emb|CCA94019.1| lactoylglutathione lyase [Novosphingobium sp. PP1Y] Length = 131 Score = 74.7 bits (182), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 32/52 (61%), Positives = 41/52 (78%) Query: 1 LENEHARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHYI 52 L+ EHAR+ + GI P P+KEF R ++ARFFFIQDPDGYKIE+L+R G Y+ Sbjct: 80 LDAEHARMEASGIAPAPIKEFFRDGSLMARFFFIQDPDGYKIEILQRHGRYV 131 >ref|YP_001523877.1| lactoylglutathione lyase [Azorhizobium caulinodans ORS 571] dbj|BAF86959.1| lactoylglutathione lyase [Azorhizobium caulinodans ORS 571] Length = 131 Score = 72.8 bits (177), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 32/52 (61%), Positives = 40/52 (76%) Query: 1 LENEHARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHYI 52 +E EHARL + G+ P P+++FK D+ LARFFFI DPDGYK EV+ER G YI Sbjct: 80 VEAEHARLEAAGLAPGPIRDFKHEDKTLARFFFITDPDGYKTEVIERGGRYI 131 >ref|YP_004362247.1| glyoxalase/bleomycin resistance protein/dioxygenase [Burkholderia gladioli BSR3] gb|AEA62291.1| glyoxalase/bleomycin resistance protein/dioxygenase [Burkholderia gladioli BSR3] Length = 132 Score = 71.6 bits (174), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Query: 3 NEHARLTSLGINPTPLKEFKRGD-EMLARFFFIQDPDGYKIEVLERAGHY 51 E ARL SLG+ P LKEF+ G E++ARFFFI+DPDGYKIEVLER GHY Sbjct: 82 GERARLISLGMQPRDLKEFRDGQGELIARFFFIEDPDGYKIEVLERHGHY 131 >ref|YP_001170127.1| hypothetical protein Rsph17025_3968 [Rhodobacter sphaeroides ATCC 17025] gb|ABP72822.1| hypothetical protein Rsph17025_3968 [Rhodobacter sphaeroides ATCC 17025] Length = 131 Score = 71.2 bits (173), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 32/48 (66%), Positives = 38/48 (79%) Query: 4 EHARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHY 51 EHARLT+ G+NP L +F G E++ARFFFI DPDGY+IEVLER G Y Sbjct: 83 EHARLTAAGLNPRKLVDFAPGGEVIARFFFIADPDGYQIEVLERGGRY 130 >ref|YP_002982065.1| glyoxalase/bleomycin resistance protein/dioxygenase [Ralstonia pickettii 12D] gb|ACS63393.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Ralstonia pickettii 12D] Length = 131 Score = 71.2 bits (173), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 33/49 (67%), Positives = 37/49 (75%) Query: 3 NEHARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHY 51 ++HA L G P +KEFK D +LARFFFIQDPDGYKIEVLER GHY Sbjct: 82 SKHAELLRAGYEPLAVKEFKANDALLARFFFIQDPDGYKIEVLERLGHY 130 >ref|YP_001900092.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Ralstonia pickettii 12J] ref|ZP_07676348.1| lactoylglutathione lyase [Ralstonia sp. 5_7_47FAA] gb|ACD27660.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Ralstonia pickettii 12J] gb|EFP65252.1| lactoylglutathione lyase [Ralstonia sp. 5_7_47FAA] Length = 131 Score = 70.9 bits (172), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 33/49 (67%), Positives = 36/49 (73%) Query: 3 NEHARLTSLGINPTPLKEFKRGDEMLARFFFIQDPDGYKIEVLERAGHY 51 +HA L G P +KEFK D +LARFFFIQDPDGYKIEVLER GHY Sbjct: 82 TKHAELLRAGYEPLAVKEFKANDALLARFFFIQDPDGYKIEVLERLGHY 130