BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0004.0018.p (108 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003774286.1| thioredoxin 1 [Herbaspirillum seropedicae Sm... 216 1e-54 ref|ZP_08275522.1| Thioredoxin [Oxalobacteraceae bacterium IMCC9... 195 1e-48 ref|YP_001352313.1| thioredoxin [Janthinobacterium sp. Marseille... 195 2e-48 ref|YP_004751530.1| thioredoxin [Collimonas fungivorans Ter331] ... 192 2e-47 ref|YP_001099027.1| thioredoxin [Herminiimonas arsenicoxydans] >... 190 5e-47 ref|ZP_02910019.1| thioredoxin [Burkholderia ambifaria MEX-5] >g... 184 3e-45 ref|ZP_04575934.1| thioredoxin [Oxalobacter formigenes HOxBLS] >... 183 6e-45 ref|YP_369367.1| thioredoxin [Burkholderia sp. 383] >gi|10702899... 182 1e-44 ref|YP_333769.1| thioredoxin 1 [Burkholderia pseudomallei 1710b]... 181 4e-44 ref|YP_108117.1| thioredoxin 1 [Burkholderia pseudomallei K96243... 180 6e-44 >ref|YP_003774286.1| thioredoxin 1 [Herbaspirillum seropedicae SmR1] gb|ADJ62378.1| thioredoxin 1 (redox factor) protein [Herbaspirillum seropedicae SmR1] Length = 108 Score = 216 bits (549), Expect = 1e-54, Method: Compositional matrix adjust. Identities = 108/108 (100%), Positives = 108/108 (100%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD Sbjct: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI Sbjct: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 >ref|ZP_08275522.1| Thioredoxin [Oxalobacteraceae bacterium IMCC9480] gb|EGF31003.1| Thioredoxin [Oxalobacteraceae bacterium IMCC9480] Length = 108 Score = 195 bits (496), Expect = 1e-48, Method: Compositional matrix adjust. Identities = 93/108 (86%), Positives = 102/108 (94%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MS+ IKHI+DASFE DVLKSDKPVLVDFWAEWCGPCK+IAPILEE+AKEY+GKL IAK+D Sbjct: 1 MSENIKHITDASFEIDVLKSDKPVLVDFWAEWCGPCKSIAPILEEIAKEYDGKLLIAKMD 60 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VD+NQA+PAKFGIRGIPTLILFKNG AAQKVGA+AKGQL SFIDSNI Sbjct: 61 VDSNQAVPAKFGIRGIPTLILFKNGVPAAQKVGAMAKGQLTSFIDSNI 108 >ref|YP_001352313.1| thioredoxin [Janthinobacterium sp. Marseille] gb|ABR91158.1| thioredoxin [Janthinobacterium sp. Marseille] Length = 108 Score = 195 bits (496), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 94/108 (87%), Positives = 101/108 (93%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MS+ IKHI+DASF+ DVLKSDKPVLVDFWAEWCGPCK IAPILE+VAKEY GK+QI K+D Sbjct: 1 MSENIKHITDASFDTDVLKSDKPVLVDFWAEWCGPCKMIAPILEDVAKEYAGKIQITKMD 60 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VDANQAIPAKFGIRGIPTLILFKNGA AAQKVGALAKGQL +FIDSNI Sbjct: 61 VDANQAIPAKFGIRGIPTLILFKNGAPAAQKVGALAKGQLTAFIDSNI 108 >ref|YP_004751530.1| thioredoxin [Collimonas fungivorans Ter331] gb|AEK60707.1| thioredoxin [Collimonas fungivorans Ter331] Length = 108 Score = 192 bits (488), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 94/108 (87%), Positives = 98/108 (90%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MS+ IKH SDA+FEADVLKSDKPVLVDFWAEWCGPCK IAPILEEVAKEY KLQI KLD Sbjct: 1 MSEHIKHTSDATFEADVLKSDKPVLVDFWAEWCGPCKMIAPILEEVAKEYGDKLQIVKLD 60 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VD+NQA+PAK GIRGIPTLILFKNG AAQKVGALAKGQL SFIDSNI Sbjct: 61 VDSNQAVPAKHGIRGIPTLILFKNGVPAAQKVGALAKGQLTSFIDSNI 108 >ref|YP_001099027.1| thioredoxin [Herminiimonas arsenicoxydans] emb|CAL60900.1| thioredoxin [Herminiimonas arsenicoxydans] Length = 108 Score = 190 bits (483), Expect = 5e-47, Method: Compositional matrix adjust. Identities = 91/108 (84%), Positives = 99/108 (91%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MS+ I HI+DASF+ DVLKSD PVLVDFWAEWCGPCK IAPILE+VAKEY GK++IAK+D Sbjct: 1 MSENITHITDASFDTDVLKSDTPVLVDFWAEWCGPCKMIAPILEDVAKEYAGKIRIAKMD 60 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VDANQAIPAKFGIRGIPTLILFKNG AAQKVGALAKGQL +FIDSNI Sbjct: 61 VDANQAIPAKFGIRGIPTLILFKNGVPAAQKVGALAKGQLTAFIDSNI 108 >ref|ZP_02910019.1| thioredoxin [Burkholderia ambifaria MEX-5] gb|EDT38857.1| thioredoxin [Burkholderia ambifaria MEX-5] Length = 108 Score = 184 bits (468), Expect = 3e-45, Method: Compositional matrix adjust. Identities = 88/108 (81%), Positives = 99/108 (91%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MS+ IKHISDASFE DV+KSDKPVLVDFWAEWCGPCK IAPIL+EVAK+Y KLQIAK++ Sbjct: 1 MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 60 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VD NQA PAKFG+RGIPTLILFKNGAAAAQKVGAL+K QL +F+DSN+ Sbjct: 61 VDDNQATPAKFGVRGIPTLILFKNGAAAAQKVGALSKSQLTAFLDSNL 108 >ref|ZP_04575934.1| thioredoxin [Oxalobacter formigenes HOxBLS] gb|EEO26896.1| thioredoxin [Oxalobacter formigenes HOxBLS] Length = 132 Score = 183 bits (465), Expect = 6e-45, Method: Compositional matrix adjust. Identities = 85/108 (78%), Positives = 96/108 (88%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 M++ IK ISDASFE DVLKSDKPVLVDFWAEWCGPCK +API++EVAKEY GKL AK+D Sbjct: 25 MTNTIKTISDASFETDVLKSDKPVLVDFWAEWCGPCKMVAPIIDEVAKEYAGKLNFAKMD 84 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VD+NQ PAKFGIRGIPTLILFKNGA +QKVGAL+K QL++FIDSNI Sbjct: 85 VDSNQVTPAKFGIRGIPTLILFKNGAIVSQKVGALSKNQLMAFIDSNI 132 >ref|YP_369367.1| thioredoxin [Burkholderia sp. 383] ref|YP_626088.1| thioredoxin [Burkholderia cenocepacia AU 1054] ref|YP_773656.1| thioredoxin [Burkholderia ambifaria AMMD] ref|YP_835472.1| thioredoxin [Burkholderia cenocepacia HI2424] ref|YP_001119594.1| thioredoxin [Burkholderia vietnamiensis G4] ref|YP_001579630.1| thioredoxin [Burkholderia multivorans ATCC 17616] ref|ZP_02379417.1| thioredoxin 1 [Burkholderia ubonensis Bu] ref|ZP_02892461.1| thioredoxin [Burkholderia ambifaria IOP40-10] ref|YP_001765135.1| thioredoxin [Burkholderia cenocepacia MC0-3] ref|YP_001808440.1| thioredoxin [Burkholderia ambifaria MC40-6] ref|YP_001946254.1| thioredoxin 1 [Burkholderia multivorans ATCC 17616] ref|YP_002231027.1| thioredoxin [Burkholderia cenocepacia J2315] ref|ZP_03571144.1| thioredoxin [Burkholderia multivorans CGD2M] ref|ZP_03581414.1| thioredoxin [Burkholderia multivorans CGD2] ref|ZP_03588130.1| thioredoxin [Burkholderia multivorans CGD1] ref|ZP_04941377.1| Thioredoxin [Burkholderia cenocepacia PC184] gb|ABB08723.1| Thioredoxin [Burkholderia sp. 383] gb|ABF81115.1| thioredoxin [Burkholderia cenocepacia AU 1054] gb|ABI87322.1| thioredoxin [Burkholderia ambifaria AMMD] gb|ABK08579.1| thioredoxin [Burkholderia cenocepacia HI2424] gb|EAY64548.1| Thioredoxin [Burkholderia cenocepacia PC184] gb|ABO54759.1| thioredoxin [Burkholderia vietnamiensis G4] gb|ABX15133.1| thioredoxin [Burkholderia multivorans ATCC 17616] gb|ACA91013.1| thioredoxin [Burkholderia cenocepacia MC0-3] gb|EDT01971.1| thioredoxin [Burkholderia ambifaria IOP40-10] gb|ACB64224.1| thioredoxin [Burkholderia ambifaria MC40-6] dbj|BAG43718.1| thioredoxin 1 [Burkholderia multivorans ATCC 17616] emb|CAR52200.1| thioredoxin [Burkholderia cenocepacia J2315] gb|EED97578.1| thioredoxin [Burkholderia multivorans CGD1] gb|EEE04268.1| thioredoxin [Burkholderia multivorans CGD2] gb|EEE14431.1| thioredoxin [Burkholderia multivorans CGD2M] gb|EGD00961.1| thioredoxin [Burkholderia sp. TJI49] Length = 108 Score = 182 bits (463), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 87/108 (80%), Positives = 99/108 (91%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MS+ IKHISDASFE DV+KSDKPVLVDFWAEWCGPCK IAPIL+EVAK+Y KLQIAK++ Sbjct: 1 MSEQIKHISDASFEQDVVKSDKPVLVDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 60 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VD NQA PAKFG+RGIPTLILFKNGAAAAQKVGAL+K QL +F+DS++ Sbjct: 61 VDDNQATPAKFGVRGIPTLILFKNGAAAAQKVGALSKSQLTAFLDSHL 108 >ref|YP_333769.1| thioredoxin 1 [Burkholderia pseudomallei 1710b] gb|ABA51067.1| thioredoxin 1 [Burkholderia pseudomallei 1710b] Length = 146 Score = 181 bits (458), Expect = 4e-44, Method: Compositional matrix adjust. Identities = 85/108 (78%), Positives = 98/108 (90%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MS+ IKHISDASFE DV+KSDKPVL+DFWAEWCGPCK IAPIL+EVAK+Y KLQIAK++ Sbjct: 39 MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 98 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VD NQA PAKFG+RGIPTLILFKNGA AAQKVGAL+K QL +F+DS++ Sbjct: 99 VDENQATPAKFGVRGIPTLILFKNGAVAAQKVGALSKSQLTAFLDSHL 146 >ref|YP_108117.1| thioredoxin 1 [Burkholderia pseudomallei K96243] ref|YP_103023.1| thioredoxin [Burkholderia mallei ATCC 23344] ref|ZP_00438507.1| thioredoxin [Burkholderia mallei GB8 horse 4] ref|YP_993172.1| thioredoxin [Burkholderia mallei SAVP1] ref|YP_001026053.1| thioredoxin [Burkholderia mallei NCTC 10229] ref|YP_001059243.1| thioredoxin [Burkholderia pseudomallei 668] ref|YP_001080679.1| thioredoxin [Burkholderia mallei NCTC 10247] ref|YP_001066510.1| thioredoxin [Burkholderia pseudomallei 1106a] ref|ZP_01764472.1| thioredoxin [Burkholderia pseudomallei 305] ref|ZP_02269231.1| thioredoxin [Burkholderia mallei PRL-20] ref|ZP_02402480.1| thioredoxin 1 [Burkholderia pseudomallei DM98] ref|ZP_02411015.1| thioredoxin 1 [Burkholderia pseudomallei 14] ref|ZP_02447111.1| thioredoxin 1 [Burkholderia pseudomallei 91] ref|ZP_02455312.1| thioredoxin 1 [Burkholderia pseudomallei 9] ref|ZP_02470890.1| thioredoxin 1 [Burkholderia pseudomallei B7210] ref|ZP_02481327.1| thioredoxin 1 [Burkholderia pseudomallei 7894] ref|ZP_02489582.1| thioredoxin 1 [Burkholderia pseudomallei NCTC 13177] ref|ZP_02497708.1| thioredoxin 1 [Burkholderia pseudomallei 112] ref|ZP_02505733.1| thioredoxin 1 [Burkholderia pseudomallei BCC215] ref|ZP_03452895.1| thioredoxin [Burkholderia pseudomallei 576] ref|ZP_03792662.1| thioredoxin [Burkholderia pseudomallei Pakistan 9] ref|YP_002897018.1| thioredoxin [Burkholderia pseudomallei MSHR346] ref|ZP_04816824.1| thioredoxin [Burkholderia pseudomallei 1106b] ref|ZP_04884353.1| thioredoxin [Burkholderia mallei ATCC 10399] ref|ZP_04886132.1| thioredoxin [Burkholderia pseudomallei 1655] ref|ZP_04895586.1| thioredoxin [Burkholderia pseudomallei Pasteur 52237] ref|ZP_04903749.1| thioredoxin [Burkholderia pseudomallei S13] ref|ZP_04906334.1| thioredoxin [Burkholderia mallei FMH] ref|ZP_04912653.1| thioredoxin [Burkholderia mallei JHU] ref|ZP_04949349.1| thioredoxin [Burkholderia pseudomallei 1710a] ref|ZP_04964865.1| thioredoxin [Burkholderia pseudomallei 406e] ref|ZP_04974558.1| thioredoxin [Burkholderia mallei 2002721280] emb|CAH35498.1| thioredoxin 1 [Burkholderia pseudomallei K96243] gb|AAU47591.1| thioredoxin [Burkholderia mallei ATCC 23344] gb|ABM52855.1| thioredoxin [Burkholderia mallei SAVP1] gb|ABN01697.1| thioredoxin [Burkholderia mallei NCTC 10229] gb|ABN83944.1| thioredoxin [Burkholderia pseudomallei 668] gb|ABN91321.1| thioredoxin [Burkholderia pseudomallei 1106a] gb|ABO05498.1| thioredoxin [Burkholderia mallei NCTC 10247] gb|EBA51486.1| thioredoxin [Burkholderia pseudomallei 305] gb|EDK56638.1| thioredoxin [Burkholderia mallei FMH] gb|EDK60809.1| thioredoxin [Burkholderia mallei JHU] gb|EDK85433.1| thioredoxin [Burkholderia mallei 2002721280] gb|EDO85186.1| thioredoxin [Burkholderia pseudomallei 406e] gb|EDO92424.1| thioredoxin [Burkholderia pseudomallei Pasteur 52237] gb|EDP88707.1| thioredoxin [Burkholderia mallei ATCC 10399] gb|EDS86761.1| thioredoxin [Burkholderia pseudomallei S13] gb|EDU07116.1| thioredoxin [Burkholderia pseudomallei 1655] gb|EEC35151.1| thioredoxin [Burkholderia pseudomallei 576] gb|EEH26474.1| thioredoxin [Burkholderia pseudomallei Pakistan 9] gb|ACQ96252.1| thioredoxin [Burkholderia pseudomallei MSHR346] gb|EEP83716.1| thioredoxin [Burkholderia mallei GB8 horse 4] gb|EES27449.1| thioredoxin [Burkholderia pseudomallei 1106b] gb|EES43194.1| thioredoxin [Burkholderia mallei PRL-20] gb|EET06368.1| thioredoxin [Burkholderia pseudomallei 1710a] Length = 108 Score = 180 bits (457), Expect = 6e-44, Method: Compositional matrix adjust. Identities = 85/108 (78%), Positives = 98/108 (90%) Query: 1 MSDIIKHISDASFEADVLKSDKPVLVDFWAEWCGPCKAIAPILEEVAKEYEGKLQIAKLD 60 MS+ IKHISDASFE DV+KSDKPVL+DFWAEWCGPCK IAPIL+EVAK+Y KLQIAK++ Sbjct: 1 MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN 60 Query: 61 VDANQAIPAKFGIRGIPTLILFKNGAAAAQKVGALAKGQLVSFIDSNI 108 VD NQA PAKFG+RGIPTLILFKNGA AAQKVGAL+K QL +F+DS++ Sbjct: 61 VDENQATPAKFGVRGIPTLILFKNGAVAAQKVGALSKSQLTAFLDSHL 108