BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0030.0237.p (121 letters) Database: COGmodified 192,987 sequences; 59,019,183 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value RSc1283 [T] COG0664 cAMP-binding proteins - catabolite gene acti... 75 3e-14 NMB0380 [T] COG0664 cAMP-binding proteins - catabolite gene acti... 69 2e-12 NMA2107 [T] COG0664 cAMP-binding proteins - catabolite gene acti... 69 2e-12 VC1434 [T] COG0664 cAMP-binding proteins - catabolite gene activ... 67 1e-11 fnr [T] COG0664 cAMP-binding proteins - catabolite gene activato... 62 3e-10 Zfnr [T] COG0664 cAMP-binding proteins - catabolite gene activat... 62 3e-10 ECs1915 [T] COG0664 cAMP-binding proteins - catabolite gene acti... 62 3e-10 YPO2300 [T] COG0664 cAMP-binding proteins - catabolite gene acti... 61 6e-10 STM1660 [T] COG0664 cAMP-binding proteins - catabolite gene acti... 61 6e-10 HI1425 [T] COG0664 cAMP-binding proteins - catabolite gene activ... 59 2e-09 >RSc1283 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases Rso Ralstonia solanacearum Length = 242 Score = 75.5 bits (184), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 38/81 (46%), Positives = 59/81 (72%) Query: 11 RSEQRFASFLLDLSRISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKFRKARLI 70 R+E+R A+FLL+LSR S+ G +STEF LRMSR ++G +LGL E++SRL S+F +A LI Sbjct: 159 RAEERLAAFLLNLSRRSAERGYSSTEFVLRMSREELGSYLGLKLETVSRLFSRFAEAGLI 218 Query: 71 DVSVRNVRMLSPCTLEELASG 91 + R+V+++ L ++ +G Sbjct: 219 QIRQRHVKLIDMAGLRQVMTG 239 >NMB0380 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases Nme Neisseria meningitidis MC58 Length = 244 Score = 68.9 bits (167), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 40/87 (45%), Positives = 62/87 (71%), Gaps = 2/87 (2%) Query: 6 LLLKARSEQRFASFLLDLS-RISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKF 64 LL R+E+R A+FLL+LS R+ SR G A+ +F LRMSR +IG +LGL E++SR +SKF Sbjct: 154 LLGNMRAEERIAAFLLNLSQRLYSR-GFAANDFILRMSREEIGSYLGLKLETVSRTLSKF 212 Query: 65 RKARLIDVSVRNVRMLSPCTLEELASG 91 + LI V +++++L+ L+++ SG Sbjct: 213 HQEGLISVEHKHIKILNLQVLKKMVSG 239 >NMA2107 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases NmA Neisseria meningitidis Z2491 Length = 244 Score = 68.9 bits (167), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 40/87 (45%), Positives = 62/87 (71%), Gaps = 2/87 (2%) Query: 6 LLLKARSEQRFASFLLDLS-RISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKF 64 LL R+E+R A+FLL+LS R+ SR G A+ +F LRMSR +IG +LGL E++SR +SKF Sbjct: 154 LLGNMRAEERIAAFLLNLSQRLYSR-GFAANDFILRMSREEIGSYLGLKLETVSRTLSKF 212 Query: 65 RKARLIDVSVRNVRMLSPCTLEELASG 91 + LI V +++++L+ L+++ SG Sbjct: 213 HQEGLISVEHKHIKILNLQVLKKMVSG 239 >VC1434 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases Vch Vibrio cholerae Length = 250 Score = 66.6 bits (161), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 36/85 (42%), Positives = 56/85 (65%) Query: 6 LLLKARSEQRFASFLLDLSRISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKFR 65 LL K +E+R A+FL +LS S+ G + EF L M+R DIG +LGLT E++SRL+ +F+ Sbjct: 160 LLSKKNAEERLAAFLYNLSTRFSQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 219 Query: 66 KARLIDVSVRNVRMLSPCTLEELAS 90 K+ ++ V + + +L+ L ELA Sbjct: 220 KSEILSVKGKYITILNHAELMELAG 244 >fnr [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases Eco Escherichia coli K12 Length = 250 Score = 62.0 bits (149), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 33/85 (38%), Positives = 56/85 (65%) Query: 6 LLLKARSEQRFASFLLDLSRISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKFR 65 LL K +E+R A+F+ +LSR ++ G + EF L M+R DIG +LGLT E++SRL+ +F+ Sbjct: 160 LLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 219 Query: 66 KARLIDVSVRNVRMLSPCTLEELAS 90 K+ ++ V + + + + L +LA Sbjct: 220 KSGMLAVKGKYITIENNDALAQLAG 244 >Zfnr [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases EcZ Escherichia coli O157:H7 EDL933 Length = 250 Score = 62.0 bits (149), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 33/85 (38%), Positives = 56/85 (65%) Query: 6 LLLKARSEQRFASFLLDLSRISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKFR 65 LL K +E+R A+F+ +LSR ++ G + EF L M+R DIG +LGLT E++SRL+ +F+ Sbjct: 160 LLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 219 Query: 66 KARLIDVSVRNVRMLSPCTLEELAS 90 K+ ++ V + + + + L +LA Sbjct: 220 KSGMLAVKGKYITIENNDALAQLAG 244 >ECs1915 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases Ecs Escherichia coli O157:H7 Length = 250 Score = 62.0 bits (149), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 33/85 (38%), Positives = 56/85 (65%) Query: 6 LLLKARSEQRFASFLLDLSRISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKFR 65 LL K +E+R A+F+ +LSR ++ G + EF L M+R DIG +LGLT E++SRL+ +F+ Sbjct: 160 LLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 219 Query: 66 KARLIDVSVRNVRMLSPCTLEELAS 90 K+ ++ V + + + + L +LA Sbjct: 220 KSGMLAVKGKYITIENNDALAQLAG 244 >YPO2300 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases Ype Yersinia pestis Length = 250 Score = 61.2 bits (147), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 32/85 (37%), Positives = 55/85 (64%) Query: 6 LLLKARSEQRFASFLLDLSRISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKFR 65 LL K +E+R A+F+ +LS ++ G + EF L M+R DIG +LGLT E++SRL+ +F+ Sbjct: 160 LLSKKNAEERLAAFIYNLSHRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 219 Query: 66 KARLIDVSVRNVRMLSPCTLEELAS 90 K+ ++ V + + + + L +LA Sbjct: 220 KSNILSVKGKYITIENNEALAQLAG 244 >STM1660 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases Sty Salmonella typhimurium LT2 Length = 264 Score = 61.2 bits (147), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 33/85 (38%), Positives = 55/85 (64%) Query: 6 LLLKARSEQRFASFLLDLSRISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKFR 65 LL K +E+R A+F+ +LSR ++ G + EF L M+R DIG +LGLT E++SRL+ +F+ Sbjct: 174 LLSKKNAEERLAAFIYNLSRRFAQRGFSPREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 233 Query: 66 KARLIDVSVRNVRMLSPCTLEELAS 90 K+ ++ V + + + + L LA Sbjct: 234 KSGMLAVKGKYITIENSDALAALAG 258 >HI1425 [T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases Hin Haemophilus influenzae Length = 257 Score = 59.3 bits (142), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 31/74 (41%), Positives = 50/74 (67%) Query: 6 LLLKARSEQRFASFLLDLSRISSRCGNASTEFSLRMSRTDIGLFLGLTNESMSRLISKFR 65 LL K +E+R A+F+ +LS+ S G ++ EF L M+R DIG +LGLT E++SRL+ +F+ Sbjct: 163 LLSKMNAEERLAAFIHNLSKRYSARGFSAREFRLTMTRGDIGNYLGLTVETISRLLGRFQ 222 Query: 66 KARLIDVSVRNVRM 79 K +I V + + + Sbjct: 223 KLGVISVQGKYITI 236